4UPB,2VYC,1ORD


Conserved Protein Domain Family
OKR_DC_1_N

?
pfam03709: OKR_DC_1_N 
Click on image for an interactive view with Cn3D
Orn/Lys/Arg decarboxylase, N-terminal domain
This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure.
Statistics
?
Aligned: 80 rows
Threshold Bit Score: 62.2499
Threshold Setting Gi: 75363036
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4UPB_A                   14 FKEEPIRELHRALERLNFQIVYPNDRDDLLKLIENNARLCGVIFDWD-----KYNLELCEEISKMNENLPLYAFANTY-S 87  Esch...
Q83W85                   11 FDNKYVAEIISHLHTKNFGTELAGCSEKIETIIRNNARIAAVLLDLD------DSNDILDKIRMLNEHLPVFLLKTDDvA 84  Esch...
EDJ89238                 10 KSTYHTKSLTHCLQRQNYQVLEVCLRAELLNLIKNNARIVAVILNMDffnddFFSQELVKKMNMINENLPIFLLKDSE-N 88  Haem...
Q0I358                   10 MYNDHLQNLISALEEKGYKTTAVDGHQEILHAVKNNASIISVILSND-----IIDKDLTDKILLLNEDLPIFSLKDTDdL 84  Hist...
PRJNA282520:CH582_08055  10 RENSYINELMLSLEQQGYSLIIVDNSEELLTIIRNNARLASVLFTYD-----IFNEGLTDKIIELNETLPVFLLKDTNdC 84  Haem...
nankaitd:VCM66_0266      36 FKEEPVRQLHAALEKAGYDVVYPVDDKDLIKMIEMNPRICGVLFDWD-----KYSLELCERISKVNEKLPVHAFANEQ-S 109 Vibr...
wugsc:ESA_03153          14 YKDEPMKELQAALQQQGFQLIWPKNSNDLLKFIEHNPRICGVIFDWD-----EYSLDLCCEINQLNEYLPLYAFINTH-S 87  Cron...
wugsc:KPN_00199          26 HKDEPIKELEAALQRQGFQTIWPQNSADLLQFIEHNPRICGVIFDWD-----EYSVDLCSDINQLNEYLPLYAFINAH-S 99  Kleb...
CAL13297                 14 YKDEPIRELNDALLARGFQLIYPKSRGDLLKLIEHNARIIGVIFDWD-----QHSNELCAEINDLNEYLPLYAFINTT-S 87  Yers...
jgi:Spro_3773            14 YKDEPIRELHTALAAMDFQLVYPKNSGDLLKLVEANARICGVIFDWD-----DYSLELCSDINELNEYLPLYAFINTH-S 87  Serr...
4UPB_A                   88 TLDVSLNDLRLQISFFEYALGAAEDIANKIKQTTDEY 124 Escherichia coli K-12
Q83W85                   85 IKKFCFDSFDGNVHLIDCCLYSVDEIVNKIQKIINDY 121 Escherichia coli
EDJ89238                 89 DEELDFESLENNVQYIEGHLYSEQDILHKIEKAVANY 125 Haemophilus influenzae 22.1-21
Q0I358                   85 NENLDFATIGHHVQFVDCNLYTLDEIIHKIERAVEKY 121 Histophilus somni 129PT
PRJNA282520:CH582_08055  85 NANVDYHKIGNHAQFIDCNLYTQTEVISKIQKAIRQY 121 Haemophilus influenzae
nankaitd:VCM66_0266     110 TLDISLTDLRLNVHFFEYALGMADDIAIKINQATQEY 146 Vibrio cholerae M66-2
wugsc:ESA_03153          88 TLDVSANEMRMALWFFEYSLGIADDIATRIRQYTQEY 124 Cronobacter sakazakii ATCC BAA-894
wugsc:KPN_00199         100 TMDVSSQDLRMTLWFFEYALGLSEEIATRIGQYTREY 136 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
CAL13297                 88 SLDVSLNEMRMALYFFEYTLNAAEDIAQHIEQYTAEY 124 Yersinia enterocolitica subsp. enterocolitica 8081
jgi:Spro_3773            88 TFDVSLHEMRMALYFFEYALNAADDIAQRIQQYTAEY 124 Serratia proteamaculans 568
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap