4UPB,2VYC,6Q6I,1ORD


Conserved Protein Domain Family
OKR_DC_1_N

?
pfam03709: OKR_DC_1_N 
Orn/Lys/Arg decarboxylase, N-terminal domain
This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure.
Statistics
?
PSSM-Id: 397666
View PSSM: pfam03709
Aligned: 81 rows
Threshold Bit Score: 63.4157
Threshold Setting Gi: 75363036
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4UPB_A               14 FKEEPIRELHRALER-LNFQIVYPNDRDDLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLYAFANTY-STLDV 91 
Q83W85               11 FDNKYVAEIISHLHT-KNFGTELAGCSEKIETIIRNNARIAAVLLDLD-DSNDILDKIRMLNEHLPVFLLKTDDvAIKKF 88  Escheric...
Q0I358               10 MYNDHLQNLISALEE-KGYKTTAVDGHQEILHAVKNNASIISVILSNDIIDKDLTDKILLLNEDLPIFSLKDTDdLNENL 88  Histophi...
KMZ32015             10 RENSYINELMLSLEQ-QGYSLIIVDNSEELLTIIRNNARLASVLFTYDIFNEGLTDKIIELNETLPVFLLKDTNdCNANV 88  Haemophi...
ORU05682             15 YKEKFLLKIEKDLKNhHEYYTLKLDDLSEVVEILEENSRICCIVLDRASFNIEAFHNIAHLNTKLPIFVASDYS-QSIKL 93  Francise...
nankaitd:VCM66_0266  36 FKEEPVRQLHAALEK-AGYDVVYPVDDKDLIKMIEMNPRICGVLFDWDKYSLELCERISKVNEKLPVHAFANEQ-STLDI 113 Vibrio c...
wugsc:ESA_03153      14 YKDEPMKELQAALQQ-QGFQLIWPKNSNDLLKFIEHNPRICGVIFDWDEYSLDLCCEINQLNEYLPLYAFINTH-STLDV 91  Cronobac...
wugsc:KPN_00199      26 HKDEPIKELEAALQR-QGFQTIWPQNSADLLQFIEHNPRICGVIFDWDEYSVDLCSDINQLNEYLPLYAFINAH-STMDV 103 Klebsiel...
WP_011816963         14 YKDEPIRELNDALLA-RGFQLIYPKSRGDLLKLIEHNARIIGVIFDWDQHSNELCAEINDLNEYLPLYAFINTT-SSLDV 91  Yersinia...
WP_012146478         14 YKDEPIRELHTALAA-MDFQLVYPKNSGDLLKLVEANARICGVIFDWDDYSLELCSDINELNEYLPLYAFINTH-STFDV 91  Serratia
4UPB_A               92 SLNDLRLQISFFEY-ALGAAEDIANKIKQTTDEY 124
Q83W85               89 CFDSFDGNVHLIDC-CLYSVDEIVNKIQKIINDY 121 Escherichia coli
Q0I358               89 DFATIGHHVQFVDC-NLYTLDEIIHKIERAVEKY 121 Histophilus somni 129PT
KMZ32015             89 DYHKIGNHAQFIDC-NLYTQTEVISKIQKAIRQY 121 Haemophilus influenzae
ORU05682             94 NLRDFNLNINFLQYdALAGED--SDFIHKTITNY 125 Francisella tularensis subsp. holarctica
nankaitd:VCM66_0266 114 SLTDLRLNVHFFEY-ALGMADDIAIKINQATQEY 146 Vibrio cholerae M66-2
wugsc:ESA_03153      92 SANEMRMALWFFEY-SLGIADDIATRIRQYTQEY 124 Cronobacter sakazakii ATCC BAA-894
wugsc:KPN_00199     104 SSQDLRMTLWFFEY-ALGLSEEIATRIGQYTREY 136 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
WP_011816963         92 SLNEMRMALYFFEY-TLNAAEDIAQHIEQYTAEY 124 Yersinia enterocolitica
WP_012146478         92 SLHEMRMALYFFEY-ALNAADDIAQRIQQYTAEY 124 Serratia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap