Conserved Protein Domain Family
Vps26

?
pfam03643: Vps26 
Vacuolar protein sorting-associated protein 26
Vacuolar protein sorting-associated protein (Vps) 26 is one of around 50 proteins involved in protein trafficking. In particular, Vps26 assembles into a retromer complex with at least four other proteins Vps5, Vps17, Vps29 and Vps35. This family also contains Down syndrome critical region 3/A.
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 297.045
Threshold Setting Gi: 3334162
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55CA0   8 FGTPCNVEFELDNCQNRKTIEVTQD------KGKTEKLFVFIGNEPVSGKVSINIKEkTKKIEHTGIRVEF--------- 72  Dictyostelium discoideum
O75436   8 FGPICEIDIVLNDGETRKMAEMKTE------DGKVEKHYLFYDGESVSGKVNLAFKQpGKRLEHQGIRIEF--------- 72  human
Q9W552   6 FGQSADIEIVF-DGAEHKTAEVKGE------DGKVEKMLLFYDGETVSGKVNVTLKKpGSKLEHQGIKIEF--------- 69  fruit fly
O01258   7 FGQSAEIQIRLSNEDTRKIVKARGD------DGNMHDHFLYYDGESVTGTVHVNLKKaNHKFEHQGIRIEF--------- 71  Caenorhabditis elegans
Q9FJD0   8 FKPACNISITFTDGKNRKQVPTKKD------NGQIVMNPLFQSQETIAGKINIEPYQ-GKKVEHNGVKVEL--------- 71  thale cress
P40335   5 FKPPIDIEILFDNEESRKHVDIATRssnssyKSMKESLPVYEDGESLGGIVTLRVRD-SKKVDHLGIKVSV--------- 74  Saccharomyces cerevis...
Q10243   5 FKSPIDVDLHLDNEEERTFVDYEFE------QGRKDKAPIYESDETVKGTVMIRLKD-GRKLDHDGVKIEF--------- 68  Schizosaccharomyces p...
O35075   1 MGTTLDIKIKR-------------------------ANKVYHAGEMLSGVVVISSKD---SVQHQGVSLTMegtvnlqls 52  house mouse
Q55CA0  73 ---VGQIELFYDRG--------------------------NHYE-FTSLVRELAPAGELTENKT-FSYDFSNVEKQ---- 117 Dictyostelium discoideum
O75436  73 ---VGQIELFNDKS--------------------------NTHE-FVNLVKELALPGELTQSRS-YDFEFMQVEKP---- 117 human
Q9W552  70 ---IGQIELYYDRG--------------------------NHHE-FKCLAKALARPGDLIQNNS-YPFDFPKVEKQ---- 114 fruit fly
O01258  72 ---IGQIEVYYDRG--------------------------NQQD-FISLTRELARPGDLTQNAQ-FPFEFNNVEKP---- 116 Caenorhabditis elegans
Q9FJD0  72 ---LGQIEMYFDRG--------------------------NFYD-FTSLVREIDVPGEIYERKT-YPFEFSSVEMP---- 116 thale cress
P40335  75 ---IGSIDMLKSHGsgnssskkvtsstsssssngsvdvrkNSVDqFLCQSYDLCPAGELQHSQS-FPFLFRDLSKR---- 146 Saccharomyces cerevis...
Q10243  69 ---IGQIENTYDKG--------------------------NIHE-FTRSVQELASPGEMRHAQM-FEFEFKHVDKP---- 113 Schizosaccharomyces p...
O35075  53 aksVGVFEAFYNSV--------------------------KPIQ-IINSTIDVLKPGKIPSGKTeVPFEFPLLVKGskvl 105 house mouse
Q55CA0 118 YESYNGTNVRLRYFVRLTIGRSFa-SNIVKEYDIWVI-------------NF---VKPP--------------------- 159 Dictyostelium discoideum
O75436 118 YESYIGANVRLRYFLKVTIVRRL--TDLVKEYDLIVH-------------QL---ATYP--------------------- 158 human
Q9W552 115 FEVYAGSNVRLRYFLRATIVRRI--SDITKEVDIAVH-------------TL---CSYP--------------------- 155 fruit fly
O01258 117 FETYMGTNVKLRYFLRVTVIRRL--TDLTKELDLVVH-------------AL---SSYP--------------------- 157 Caenorhabditis elegans
Q9FJD0 117 YETYNGVNVRLRYVLKVTVTRGYa-GSIVEYQDFVVR-------------NY---VPLP--------------------- 158 thale cress
P40335 147 YESYKGKNVDVAYYVKVTVMRKS--TDISKIKRFWVY-------------LYnsvTTAPntlsanetkattndiaggnya 211 Saccharomyces cerevis...
Q10243 114 YESYIGKNVKLRYICRVTVSRKM--KDVIREKDLWVY-------------RF---ENEP--------------------- 154 Schizosaccharomyces p...
O35075 106 YETYHGVFVNIQYTLRCDMRRSLlaKDLTKTCEFIVHsapqkgkltpspvDF---TITP--------------------- 161 house mouse
Q55CA0 160 ------------------ESN------------SNIKMEVGIEDCLHIEFEYNKSKY----HLKDV-------IIGKIYF 198 Dictyostelium discoideum
O75436 159 ------------------DVN------------NSIKMEVGIEDCLHIEFEYNKSKY----HLKDV-------IVGKIYF 197 human
Q9W552 156 ------------------EMN------------NPIKMEVGIEDCLHIEFEYNKSKY----HLRDT-------IIGKIYF 194 fruit fly
O01258 158 ------------------DND------------KSIKMEVGIEDCLHIEFEYNKNKY----HLQDV-------IVGKIYF 196 Caenorhabditis elegans
Q9FJD0 159 ------------------PIN------------NSIKMEVGIEDCLHIEFEYNKSKY----HLKDV-------ILGKIYF 197 thale cress
P40335 212 adnasdntqtkstqgeaaDVNqvlpishsnnepKPVRLDIGIENCLHIEFEYAKSQY----SLKEV-------IVGRIYF 280 Saccharomyces cerevis...
Q10243 155 ------------------ETN------------SLIRMDVGIDECLHIEFEYSKNKY----HLKDV-------IIGKIYF 193 Schizosaccharomyces p...
O35075 162 ------------------ETL------------QNVKERA------------SLPKFfirgHLNSTncaitqpLTGE--- 196 house mouse
Q55CA0 199 LLVR---IKIKYMEIALIKRESTGS-GPNVFNESETLTKFEIMDGAPVRGESIPVRLFLSVFDLTPTYRSVHNKFSVKYF 274 Dictyostelium discoideum
O75436 198 LLVR---IKIQHMELQLIKKEITGI-GPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYF 273 human
Q9W552 195 LLVR---IKIKHMEIAIIKKESTGT-GPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNLTPTMRDINKKFSVKYF 270 fruit fly
O01258 197 LLVR---IKIKYMEIAILKTEVVGS-GPNTFKESETVAKFEIMDGAPVRGESIPIRLFLAGYDLAPSMRDVGKKFSVKYF 272 Caenorhabditis elegans
Q9FJD0 198 LLVR---IKIKNMDLEIRRRESTGA-GANTHVETETLAKFELMDGAPVRGESIPVRVFLTPYDLTPTHKNINNKFSVKYY 273 thale cress
P40335 281 LLTR---LRIKHMELSLITRESSGLqTSNVMTDS-TAIRYEIMDGSSVKGETIPIRLFLSGYDLTPNMS--CNYFNVKNY 354 Saccharomyces cerevis...
Q10243 194 ILVR---IKVQRMEVSIIRRETIGT-SPNQYSNSETITRFQIMDGNPNRGETIPLRMFLNGYALTPTFRDVNKKFSVRYY 269 Schizosaccharomyces p...
O35075 197 LVVEhsdAAIRSIELQLVRVETCGC-AEGYARDATEIQNIQIADGDICRNLSVPLYMVFPRLFTCPTLETTN--FKVEFE 273 house mouse
Q55CA0 275 LNLALVDEDD 284 Dictyostelium discoideum
O75436 274 LNLVLVDEED 283 human
Q9W552 271 LNLVLMDTED 280 fruit fly
O01258 273 LNLVLVDEED 282 Caenorhabditis elegans
Q9FJD0 274 LNLVLVDEED 283 thale cress
P40335 355 LSLVIIDEDG 364 Saccharomyces cerevisiae S288C
Q10243 270 LSLILVDEDQ 279 Schizosaccharomyces pombe 972h-
O35075 274 VNVVVLLHAD 283 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap