Conserved Protein Domain Family
LIP

?
pfam03583: LIP 
Secretory lipase
These lipases are expressed and secreted during the infection cycle of these pathogens. In particular, C. albicans has a large number of different lipases, possibly reflecting broad lipolytic activity, which may contribute to the persistence and virulence of C. albicans in human tissue.
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 342.104
Threshold Setting Gi: 81858302
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9P4E5 119 QFKSPAT--TVTTQIDMTLIVPLLQNGYYVIIPDYEGPKS-----TFTVGRQSG-KATLNSIRAALQTGAFSGIKKTAKV 190 Candida albicans SC5314
Q5APG1 119 QFGSPLS--TITTQIDMTLIVPPLRSGYYVVTPDYEGPKA-----TFAVGRQSG-QATLDSVRAILKSGSFSGINEDAKV 190 Candida albicans
Q9P4E8 119 QLGAPLS--TILTQLDMTFIVPPLKSGYYVVLPDYEGPKS-----TFGVGRQSG-KATLDSIKAVLKTKDFSGINDDAKV 190 Candida albicans SC5314
Q9P4E6 117 QFGSDVS--TLATQAETYLLAPLLDKGYYVVSPDYEGPKS-----TFTVGKQSG-QAVLNSIRASLKSGKITNIAEDAKV 188 Candida albicans SC5314
Q9P8V9 117 QFGSDLS--TLATQAETFLLAPLLEQGYYVVSPDYEGPKS-----TFTIGKQSG-QAVLNSIRAALKSGKITNIKDDAKV 188 Candida albicans SC5314
Q9P4E7 115 QVPS-FE--TFQIQADLIFISGLLSQGWYVVVPDYEGPNS-----VFPVGRQSA-YSVLDSIRGTIKFFNSTG-NSTVKT 184 Candida albicans SC5314
Q9L181 142 EHPLQLNgqTVSVGYEDLSVYRLLLRGVAVVVTDYVGLGTtdrlhTY-VNRVDGaHAVLDAVRAAR-SLDSASVTSDSRV 219 Streptomyces coelicolor
P9WK89 129 RRRAKAL--GSLTQMELLMISAALAEGWAVSVPDHEGPKG-----LWGSPYEPG-YRVLDGIRAALNSERV-GLSPATPI 199 Mycobacterium tubercu...
Q9P4E5 191 ALWGYSGGSLATGWAISLQSKYAPELKenLIGAAVGGFATNITAVAEAVDGTVFSGFIPLALNGLANEYPDFKKRLYGEV 270 Candida albicans SC5314
Q5APG1 191 ALWGYSGGSLATGWAAALQPVYAPELQknIVGAAVGGFAANITAIAESVDGTIFAGLITLALNGLANEYPDLKTAFYEEL 270 Candida albicans
Q9P4E8 191 VLWGYSGGSFASGWAAVLQPEYAPELKdnLIGAALGGFAANLTGIAESVDGEVFSGFIPLALNGIANEYPDFKKRLYEEV 270 Candida albicans SC5314
Q9P4E6 189 LMWGYSGGSLASGWAAALQPDYAPELSrnLLGVALGGFITNVTATVEATDDTIFAGIAANVLGGIANEYPEFKSILQNDT 268 Candida albicans SC5314
Q9P8V9 189 VMWGYSGGSLASGWAAALQPSYAPELGgnLLGAALGGFVTNITATAQAADGTVFAGIVANALGGVANEYPEFKSILQSDT 268 Candida albicans SC5314
Q9P4E7 185 ALLGYSYGAVASLWASIVQPNYAPELE--LVGAAVGCTIPNITAFIEKVDEGPYSGLIVNIFNGLANEYRHFRDRLIHFG 262 Candida albicans SC5314
Q9L181 220 GLFGYSQGGGATAAAAELQPSYAPDVQ--LAGTYAGAPPADLTEVTKAIDGSDLAGALGWSLNGFLQTEPALRPIADRYI 297 Streptomyces coelicolor
P9WK89 200 GLWGYSGGGLASAWAAEACGEYAPDLD--IVGAVLGSPVGDLGHTFRRLNGTLLAGLPALVVAALQHSYPGLARVIKEHA 277 Mycobacterium tubercu...
Q9P4E5 271 KLSARSTMEKGSQNCLAASLVGYPMSQYFTGQNRAFEKGWGLLQDE-VFNKTIEDNLLlklDKTYLPQVPVLIYHGTIDE 349 Candida albicans SC5314
Q5APG1 271 SDFAVPEFKAGAENCLAENIFHYPLHQYFTGPKRAFEKGWGLLKED-IFNKSIQDNLLiglNKTYLPQVPVLIYHGTVDE 349 Candida albicans
Q9P4E8 271 KPGAKADLQKGAENCLAASLISYPMYQYFTGPRRVFEKGWSLLEDK-TIGKTLEDNLLialSKEHMPQIPIFVYHGTIDK 349 Candida albicans SC5314
Q9P4E6 269 NKSS--IFNKINNHCLTDSFIKYVGARFLTGDNKVFKSGWNIFKNL-VVSKIVKDNGLv-yQKQLIPTIPVFIYHGSMDQ 344 Candida albicans SC5314
Q9P8V9 269 DKKS--VFDEFDSHCLADGVIDYINTSFLTGDNKIFKTGWDILKSS-TIAKIVKDNGLv-yQKQLVPKIPIFVYHGSIDQ 344 Candida albicans SC5314
Q9P4E7 263 ALQ--------PLGCLFPICRKFFFQKMIGG-----VYDAQVLTDE-TIKETIEINNLl--STRAVPQIPVFLFHSKFNE 326 Candida albicans SC5314
Q9L181 298 NEAGQEALKDLSTMCVGDALFGYGGDS-STDWTRTGQSISDVIRAEpALQSFLAEQRI----GSTAPGSPVRVATGVSDD 372 Streptomyces coelicolor
P9WK89 278 NDEGRQLLEQLTEMTTVDAVIRMAGRDM--GDFLD-EPLEDILSTP-EISHVFGDTKL----GSAVPTPPVLIVQAVHDY 349 Mycobacterium tubercu...
Q9P4E5 350 IIPIKDANAQYQIWCDRGIQSLEFAEDLSAG-------HLAETFTGAPAALSWIDARFSGKPAVNG 408 Candida albicans SC5314
Q5APG1 350 IIPIKDPHAQYQLWCDWGIESLEFAEDLSTG-------HLAETFTGAPAALAWIDARFDGKTPIQG 408 Candida albicans
Q9P4E8 350 IIPIKDSIKIYKNWCDWGIGSFEFSEDKSNG-------HTTETVVGAPAALTWIDARFAGKPAVEG 408 Candida albicans SC5314
Q9P4E6 345 ISPILNPKKTYQNWCDAGISSIEFAEDLTNG-------HFTESIVGAPAALTWIIDRFSNKPPVDG 403 Candida albicans SC5314
Q9P8V9 345 IVPIVNVKKTYQNWCEGGISSLEFAEDGTNG-------HLTETVVGAPAALTWIIDRFNGKQTVSG 403 Candida albicans SC5314
Q9P4E7 327 MSPFLEILKLEKLWCSQLGVNLEIAEDMSYN-------HMVEAFSGMPAAITWIEKRWNNS-TLGG 384 Candida albicans SC5314
Q9L181 373 LVPHGQARRLAVDWCGKGG-KVTYVPVLIPGvgsgllnHFAPLLADQGNAIAWLTDRLSGEPAGSN 437 Streptomyces coelicolor
P9WK89 350 LIDVSDIDALADSYTAGG-ANVTYHRDLFSE-------HVSLHPLSAPMTLRWLTDRFAGKPLTDh 407 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap