Conserved Protein Domain Family
Mem_trans

?
pfam03547: Mem_trans 
Membrane transport protein
This family includes auxin efflux carrier proteins and other transporter proteins from all domains of life.
Statistics
?
PSSM-Id: 308904
View PSSM: pfam03547
Aligned: 18 rows
Threshold Bit Score: 165.257
Threshold Setting Gi: 81531183
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9C6B8   9 HVMTAMVPLYVAMILA-YGSVKWwKIFTPDQCSGINRFVALFAVPLLSFHFIAANNPYAMNLRFLAADSLQKVIVLSLLF 87  thale cress
P45869   5 DILILLAPIFFVIVLG-WFAGHF-GSYDAKSAKGVSTLVTKYALPAHFIAGILTTSRSEFLSQVPLMISLIIGIVGFYII 82  Bacillus subtilis sub...
P71425   4 VIIHALAPIFVIMLLG-FWAGKA-GMVDNKNVSLLNIFVMDFALPATLFSATVQTPWAGIVAQSPLVLVLTGAMWITYAA 81  Klebsiella pneumoniae
Q97M34   2 YVFEQIVILFLIMGIG-YYAAKS-KIIDDDTTSHLSNFIVSITLPLMILTSFNVEYSRKTVITIINLLVFSVAAFIISIV 79  Clostridium acetobuty...
O67397   2 FIYEKVFFILLIIAFA-YTLKRG-GIFKEEHALPFINYVIYFALPFTIFKNLRF---LEIGKEVLGVVLIAWGAIFLSIL 76  Aquifex aeolicus
P38355  13 LVFESVLQVVIIALAG-FWSASS-GLLPKQSQKIISLLNVDLFTPCLIFSKLAKSLSMAKIFEIAIIPIFFGLTTGISFI 90  Saccharomyces cerevis...
O14197  18 PIIESDLEVIVIALGG-YVLAKK-GFLPRDAQKVISSLNVYFFTPCLVFEKVGNGLNLKMLIDLSLLPVFYVIISAASIL 95  Schizosaccharomyces p...
Q9C9K4   9 ASSKPVVETLLITSVGfYLALDTvNLLGHDARKHLNNIVFYVFSPSLIGSRLADSVTYESLVKMWFMPVNVLLTFMIGSL 88  thale cress
Q9SHL8   9 VASMPVIQVLFMSLVGaFMASDRcKLFPVEARNSMNKVVFVLFAPALMFANLAQTVTLEDIISWWFMPVNMGLTFLIGGL 88  thale cress
Q9C999  18 SGVVPLLKLICLTVIGlLLAHPKtQLVPRATFRLLSKLVFALFLPCLIFTELGESITLDNIVQWWFIPVNVLLSAVVGSL 97  thale cress
Q9C6B8  88 LWCKLSR--NGSLDWTITLFSLSTLPNTLVMGIPLLKGMYGN-------------------FSGDLMVQIVVLQCIIWYT 146 thale cress
P45869  83 ILLVCRFifKYDLTNSSVFSLNSAQPTFAFMGIPVLGSLFGA-------------------NEVAIPIAVTGIVVNAILD 143 Bacillus subtilis sub...
P71425  82 IYFLATSvfKRTPQDGAVLTLTVALPNYAALGLPILGSVLGEg------------------ASTSLSVAVSIACGSVLMT 143 Klebsiella pneumoniae
Q97M34  80 IGKIIs--fKFAMDKRDILMFMSIFSNCGFIGFPVLKVVYGN-------------------KGVLYTSIFNLVYNVFIWT 138 Clostridium acetobuty...
O67397  77 FAFLFGKflKLEEKTLRAFLLVSSFGNTAFMGYPFLYALEGN-------------------EGLKYAILYDQLGSFLMVI 137 Aquifex aeolicus
P38355  91 SGKIMSRilDLDKDETNFVVANSVFGNSNSLPVSLTLSLAYTlpnltwdqipndnrdnvasRGILYLLIFQQIGQMLRWS 170 Saccharomyces cerevis...
O14197  96 ISFLLAKlfRLTPRQRNFATACITFQNSNSLPLALVSSLATTvkdllwdkipddtpdkvasRGIMYLLIFSQLGQALRWS 175 Schizosaccharomyces p...
Q9C9K4  89 LGWIVIVitKPPSQLRGLIISCCASGNLGTMPLIIIPAICKEkggpfgd------sescekYGMGYVTLSMT--AFFISV 160 thale cress
Q9SHL8  89 LGWLVVKilKPPPYLEGLIVATCSAGNMGNLPIILVPAICDEdkspfgn------rsvcrtVGLSYASFSMALGGFYIWT 162 thale cress
Q9C999  98 IGYLVVLicRPPPEFNRFTIVMTAFGNTGNLLLAIVSSVCHTktnpfg--------pncnsRGVSYVSFAQWVAVILVYT 169 thale cress
Q9C6B8 147 LML------------------FLFEYRGAKLLISEQFP-DTAGSIVSIHVDSDIMSLDGRQ-Pleteaeikedgklhvtv 206 thale cress
P45869 144 PLA------------------IIIATVGESSKKNEESGd----------------------------------------- 164 Bacillus subtilis sub...
P71425 144 PFC------------------LLILEREKARAAGENSG------------------------------------------ 163 Klebsiella pneumoniae
Q97M34 139 IGI------------------VIINDKREKIDY----------------------------------------------- 153 Clostridium acetobuty...
O67397 138 TLG----------------------------------------------------------------------------- 140 Aquifex aeolicus
P38355 171 WGY------------------NKLMKWSGENTQHMPPSqVQSLLERTPNIDNEELVNEEQEeQelleeennrmnssflss 232 Saccharomyces cerevis...
O14197 176 YGY------------------RILLSPNQPEDPLPIGNrSWSHSDVNEEEIQNLLASSANVdGvqnsvqanegstvqtds 237 Schizosaccharomyces p...
Q9C9K4 161 YKHdtnwyvsggngllmdlyiNLMR------VLSNSPVeTHTHSIESNYDDSCKVQLISSKeeekeednhq--------- 225 thale cress
Q9SHL8 163 YTF------------------RLIKGSAMKVQAIEESEkIAIKSSNSDLEADHKTHLLGAPedkenkvvke--------- 215 thale cress
Q9C999 170 VVY------------------HMMEPPLEYYEVVEEEG-VEIEEINVENHDASRPLLVEAEwPgiedketehcktpfiar 230 thale cress
Q9C6B8 207 rrsnasrsdiysrrsqglsatprpsnltnaeiyslqssrnptprgssfnhtdfysmmasgggrnsnfgpgeavfgskgpt 286 thale cress
P45869     -------------------------------------------------------------------------------- Bacillus subtilis sub...
P71425     -------------------------------------------------------------------------------- Klebsiella pneumoniae
Q97M34     -------------------------------------------------------------------------------- Clostridium acetobuty...
O67397     -------------------------------------------------------------------------------- Aquifex aeolicus
P38355     -------------------------------------------------------------------------------- Saccharomyces cerevis...
O14197 238 saisknd------------------------------------------------------------------------- 244 Schizosaccharomyces p...
Q9C9K4     -------------------------------------------------------------------------------- thale cress
Q9SHL8     -------------------------------------------------------------------------------- thale cress
Q9C999 231 vfnsissfsqtsf------------------------------------------------------------------- 243 thale cress
Q9C6B8 287 prpsnyeedggpakptaagtaagagrfhyqsggsgggggahypapnpgmfspntgggggtaakgnapvvggkrqdgngrd 366 thale cress
P45869     -------------------------------------------------------------------------------- Bacillus subtilis sub...
P71425     -------------------------------------------------------------------------------- Klebsiella pneumoniae
Q97M34     -------------------------------------------------------------------------------- Clostridium acetobuty...
O67397     -------------------------------------------------------------------------------- Aquifex aeolicus
P38355     -------------------------------------------------------------------------------- Saccharomyces cerevis...
O14197     -------------------------------------------------------------------------------- Schizosaccharomyces p...
Q9C9K4     -------------------------------------------------------------------------------- thale cress
Q9SHL8     -------------------------------------------------------------------------------- thale cress
Q9C999     -------------------------------------------------------------------------------- thale cress
Q9C6B8 367 lhmfvwsssaspvsdvfgggggnhhadystatndhqkdvkisvpqgnsndnqyvereefsfgnkdddskvlatdggnnis 446 thale cress
P45869     -------------------------------------------------------------------------------- Bacillus subtilis sub...
P71425     -------------------------------------------------------------------------------- Klebsiella pneumoniae
Q97M34     -------------------------------------------------------------------------------- Clostridium acetobuty...
O67397     -------------------------------------------------------------------------------- Aquifex aeolicus
P38355     -------------------------------------------------------------------------------- Saccharomyces cerevis...
O14197 245 -----------------------------------------------------------------------------nvq 247 Schizosaccharomyces p...
Q9C9K4     -------------------------------------------------------------------------------- thale cress
Q9SHL8     -------------------------------------------------------------------------------- thale cress
Q9C999 244 -----------------------------------------------------------------pevdlggeyggesss 258 thale cress
Q9C6B8 447 nkttqakvmpptsvMTRLILIMVWRKLIRNPNSYSSLFGITWSLI-SFKWNIEMP------ALIAKSISILSDAGLGMAM 519 thale cress
P45869 165 --------------SFWKMTGKSILHGLCEPLAAAPLISMILVLVfNFTLP----------ELGVKMLDQLGSTTSGVAL 220 Bacillus subtilis sub...
P71425 164 --------------STLAMLPVLMWRSVKKPIVWGPLLGVVLSAI-GIKMP----------DLLLASIKPLGLAATAAAL 218 Klebsiella pneumoniae
Q97M34 154 ------------------------KKILFNHNIIAVIVGVFLMLL-SIKIP----------YVMSSAFNLIGSMTAPLSM 198 Clostridium acetobuty...
O67397 141 --------------LFLAIGKFDLKELILFPPFIALVLSFLLHGV-RFP------------QFFEHSVEIISGSLIPVIL 193 Aquifex aeolicus
P38355 233 -------ssigdkiwqksctvferIRANLNPPLYSMIFAVVVAAI-GPLQRELFmedgfinNTFAEAVTQLGSVSIPLIL 304 Saccharomyces cerevis...
O14197 248 vetsneevggfgaasskiskFIVLLLDFFSPPLYSLFIALFIAVV-PPLQRFFFeegsfveGSITSGIRMAGQVAVPMIL 326 Schizosaccharomyces p...
Q9C9K4 226 -----vgrweevkqRVVSLSKKVNLGSIFAPATIAAIIALVIGLI-TPLRNLIIGtva-pfRVIQDSLTLLGDGAIPAMT 298 thale cress
Q9SHL8 216 ----ktgfwrkgvdFLHEI-----LEELLAPPTLGAIIGFIFGAV-RWLRNLIIGdda-plRIVQSTAKLLGDGTIPCMT 284 thale cress
Q9C999 259 prsiqclaeprvmrRIRVVAEQTPVKHILQPPTIASLLAIIIGSV-PQLKSVVFGyda-plSFITDSLNIMGSAMVPSVM 336 thale cress
Q9C6B8 520 FSLGLFMALNPRIIACGNRRAAFA--------AAMRFVVGPAVMLVASYAVGLRGV-LLHVAIIQ------------AAL 578 thale cress
P45869 221 FAVGVTVGIRKIKLSMPAIGi-----------ALLKVAVQPALMFLIALAIGLPADqTTKAILL-------------VAF 276 Bacillus subtilis sub...
P71425 219 FLTGVILSARKLQLNALIAAS-----------TIVKLLVQPFIAWGLVMLLGLHGSiAITAILM-------------IAL 274 Klebsiella pneumoniae
Q97M34 199 IVIGSILA--------GVDFNDIFkdwslyyiAILRLIIIPLIIYFALKPFQINKI-VIGVIIIC------------EAM 257 Clostridium acetobuty...
O67397 194 FSLGLRLNFTDMKSDYRTLFSA----------LFIKMFLVPLLILVFLKIFGLTSL-PYRVALIE------------SAM 250 Aquifex aeolicus
P38355 305 VVLGSNLYPSA-----EVFPKTVHhsklligsIIGRMILPSCFLLPIIAIAV-----KYINVSILddpiflvvgfllTVS 374 Saccharomyces cerevis...
O14197 327 VVLGASLATDISKTEPTQEVRKNNdtrviivcLLGRMVVVPLALLPAFSLLS-----YFSEISTVddpvfvvvifllVGS 401 Schizosaccharomyces p...
Q9C9K4 299 LILGGNLLKGMRRSEVRSSEMKNScii---gvLVARYILLPVSGVLLVRGAY------KLDLVTSeplyqf-vlllqYAV 368 thale cress
Q9SHL8 285 IILGGNLIQG-----LRSSAVKPMvvl---giVCVRYIAMPIIGIGIVLTAA------NLGFLPAdplfqy-vlmlqFTL 349 thale cress
Q9C999 337 LVLGGMLSEGPNESTLGLRTTIGI--------SVARLLVLPLVGIGIVMSAD------KLGLISSadpmfkfvlllqYST 402 thale cress
Q9C6B8 579 PQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITLLYY 617 thale cress
P45869 277 PGSAVAAMIATRFEKQEEETATAFVVSAILSLISLPIII 315 Bacillus subtilis subsp. subtilis str. 168
P71425 275 AAGFFGVVFGNRFGVQSPDAEAVLLLSSVLCILSLPLFI 313 Klebsiella pneumoniae
Q97M34 258 PGGTLCPILAKSCNRNFKYASKIVLITTILSMMTIPFMT 296 Clostridium acetobutylicum
O67397 251 PPMVFAGVLALKYELDFRLAFSAITLGIVISLFTVPVFR 289 Aquifex aeolicus
P38355 375 PPAIQLTQITQLNEFFEAEMADILFWGYAVLSLPVSIIV 413 Saccharomyces cerevisiae S288C
O14197 402 PTAIQLTQICQLNGVFERECAKVLWWSYAVFTPPNSLLL 440 Schizosaccharomyces pombe 972h-
Q9C9K4 369 PPAMNLGTKTQLFGAGESECSVIMLWTYSLAAVSLTVWP 407 thale cress
Q9SHL8 350 PPAMNIGTMTQLYNVAQDECSVLMLWTYLVAILALTVWS 388 thale cress
Q9C999 403 PSAILLGAIASLRGYAVREASALLFWQHIFALLSLTFYI 441 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap