4WV4


Conserved Protein Domain Family
TFIID_30kDa

?
pfam03540: TFIID_30kDa 
Click on image for an interactive view with Cn3D
Transcription initiation factor TFIID 23-30kDa subunit
Statistics
?
PSSM-Id: 335371
View PSSM: pfam03540
Aligned: 66 rows
Threshold Bit Score: 44.3819
Threshold Setting Gi: 255953853
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WV4_A        19 TIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMK 67  human
Q8SU50        44 LLPESVTDYFMEKAGVVTSDQSVKKLVSLLAHKFVTDIAVSSFQYHRIN 92  Encephalitozoon cuniculi
XP_002995186  25 LIPDSVLDYYMQKSGVTSSDTNVKKLVSLLSHKFISDVCASSFQYHKLR 73  Nosema ceranae BRL01
XP_001828022  19 LLPDSVIDYFLEKNGINTKNENVKKLISLMAHKFLTDVALNAFQFHKIH 67  Enterocytozoon bieneusi H348
EPR79980      20 LIPEEVIDYFLEKAGVDTADPDVKKTIALLGQKFLTDVAESSFQFHKLN 68  Spraguea lophii 42_110
EHY65208      19 LIPDVVLDHCFTKAGLTTEDPKIKKLVSLIAQKLITDVATCAYQYHKIa 67  Nematocida sp. 1 ERTm2
ELQ75002      35 LIPDIVLDHLLERSGVDCADKETKKAISLLAQKFITDVATSSFQFHKIH 83  Trachipleistophora hominis
XP_007603696  19 MIPDSIIESYCEKCGVETLDADVKKTVALMSHKFLTDVSVAAFQYHKMf 67  Vittaforma corneae ATCC 50505
XP_001302132  25 PIPDSVIKQILSECGMHTNDIRVSHIMNVVCQKFMSDVMTKCCECAKLR 73  Trichomonas vaginalis G3
EJW01939      24 LIPEPIIDYFLTKAGISYADQNVKKYISLIMQKFLTDVSISAFQYHKVi 72  Edhazardia aedis USNM 41457
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap