4WV4


Conserved Protein Domain Family
TFIID_30kDa

?
pfam03540: TFIID_30kDa 
Click on image for an interactive view with Cn3D
Transcription initiation factor TFIID 23-30kDa subunit
Statistics
?
PSSM-Id: 335371
View PSSM: pfam03540
Aligned: 66 rows
Threshold Bit Score: 44.3819
Threshold Setting Gi: 255953853
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
4WV4_A        19 TIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMK 67
gi 74621487   44 LLPESVTDYFMEKAGVVTSDQSVKKLVSLLAHKFVTDIAVSSFQYHRIN 92
gi 300705602  25 LIPDSVLDYYMQKSGVTSSDTNVKKLVSLLSHKFISDVCASSFQYHKLR 73
gi 169806555  19 LLPDSVIDYFLEKNGINTKNENVKKLISLMAHKFLTDVALNAFQFHKIH 67
gi 523781028  20 LIPEEVIDYFLEKAGVDTADPDVKKTIALLGQKFLTDVAESSFQFHKLN 68
gi 378755181  19 LIPDVVLDHCFTKAGLTTEDPKIKKLVSLIAQKLITDVATCAYQYHKIa 67
gi 440492437  35 LIPDIVLDHLLERSGVDCADKETKKAISLLAQKFITDVATSSFQFHKIH 83
gi 667638755  19 MIPDSIIESYCEKCGVETLDADVKKTVALMSHKFLTDVSVAAFQYHKMf 67
gi 123402882  25 PIPDSVIKQILSECGMHTNDIRVSHIMNVVCQKFMSDVMTKCCECAKLR 73
gi 402466456  24 LIPEPIIDYFLTKAGISYADQNVKKYISLIMQKFLTDVSISAFQYHKVi 72
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap