2GQF,3V76


Conserved Protein Domain Family
HI0933_like

?
pfam03486: HI0933_like 
Click on image for an interactive view with Cn3D
HI0933-like protein
Statistics
?
PSSM-Id: 281484
View PSSM: pfam03486
Aligned: 47 rows
Threshold Bit Score: 441.627
Threshold Setting Gi: 75244246
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GQF_A   5 SENIIIGAGAAGLFCAAQLAKLGKSVTVFDNGKKIGRKILXSGGGFCNFTNlEVTPAHYLSQ---NPHFVKSALARYTNW 81  Haemophilus influenzae
Q6AII4   4 YDVIIIGAGAAGLMAAGAAAQAGAHVALFEKMQQTGRKIGISGKGRCNLSN-SAELPEFIQHfgkNGKFLRQAFSRFFSK 82  Desulfotalea psychrop...
Q9AAG2  19 LDVAVIGGGPAGLMAAETVAKAGRSVAVFEKMPTFGRKFLMAGRGGLNLTH-SEDFDRFATRygeRSATLRPMLEAFTPQ 97  Caulobacter vibrioides
Q8XUM9   8 PLVAVIGAGPAGLMAAEVLSRAGVRVEVFDSMPSAGRKFLLAGIGGMNITH-SEAFDAFLGRyraRREQLAPLIDRFSPD 86  Ralstonia solanacearum
Q88DQ8  10 PPAVVIGGGPAGLMAAEALAKAGLAVEVFDAMPSVGRKFLLAGVGGMNITH-SEPYPAFVARyaeRQGEIEALLRDFDAD 88  Pseudomonas putida KT...
Q87W91  10 RSVAIIGGGPAGLMAAEVLSQAGFKVDLYDGMPSVGRKFLLAGVGGMNITH-SEAYPAFLARyaeRSAMIAPMLRAFDSH 88  Pseudomonas syringae ...
Q89N81   6 SHVAIIGAGPAGLMAAEVLAQGGARVTVYDAMPSAGRKFLMAGRGGLNLTH-SEPLPQFMPRyreAAAKLQAAIEAFPPD 84  Bradyrhizobium japonicum
Q6N7R9   7 IDAAVIGAGPAGLMAAEQLARGGLRVTVFDGMGAPARKFLLAGRGGLNLTH-SEAKPDFLSRygaAQARLAPAIEAFGPQ 85  Rhodopseudomonas palu...
Q8XLT7   4 KKVIVVGGGPAGIMASLTA-SANNEAVLIERNNEIGKKLRLTGGGRCNITN-NREIEEFFDKivtNNKFMYSALYTFSNY 81  Clostridium perfringens
Q895F9   2 KTVVVIGGGPAGMMAAITA-ANKCKVLLIEKNEKLGKKLFITGKGRCNVTN-KKDISDFFDYipgNPEFLYSSLYTFTNE 79  Clostridium tetani
2GQF_A  82 DFISLVAEQGITYHEKELGQLFCDE-GAEQIVEXLKSECDKYGAKILLRSEVSQVer---iQNDEKVRFVLQV--NSTQW 155 Haemophilus influenzae
Q6AII4  83 ELVELVESLGADVTLERGGRFFPTSgKALDIVEALNFWIKGTGVEVYRSAPVRKI------LVSDERIYGVKIa-DGEEL 155 Desulfotalea psychrop...
Q9AAG2  98 DLVTWAEGLGQTTFVGASGRVFPKAmKASPLLRAWLSRLEDLGVSLRPRSTWRGW--------DAMGGLRIDDpnGRNTV 169 Caulobacter vibrioides
Q8XUM9  87 ALRDWVHGLGIETFIGSSGRVFPTDmKAAPLLRAWLHRLREAGVKLHMRHRWAGWsaapsgQADQPEALRFETpdGERLV 166 Ralstonia solanacearum
Q88DQ8  89 ALRQWIHGLGIETFVGTSGRVFPTDmKAAPLLRAWLKRLRDNGVVIHTRHRWLGW--------NTDGSLRIAYpqGERQV 160 Pseudomonas putida KT...
Q87W91  89 ALCQWIHELGIETFIGSSGRVFPADmKAAPLLRAWLKRLRDAGVVIHTRHRWLGW--------NADGSLRVAHadDELAL 160 Pseudomonas syringae ...
Q89N81  85 ALRAWSAALGEPTFVGTSGRVFPRAfKASPLLRAWLRRLDASGVRFAFRHRWTGW--------DGEERLLFQTrsGTSVV 156 Bradyrhizobium japonicum
Q6N7R9  86 QLRAWADDLGQRTFVGSSGRVFPVAmKASPLLRAWLRRLDAQGVQLRLKHRWTGW--------DGEGRLLVDTpdGSRAI 157 Rhodopseudomonas palu...
Q8XLT7  82 QLLDFLSKKGLEYKVELDQKVYTKSdTAEEVISIFKNELNDCRVKVLYNTKVCDF------IVEEDEIKGIITe-QGKKI 154 Clostridium perfringens
Q895F9  80 NTIEFFNSRNTPLKIERGDRVFPSSdKSSDIIKTLEKELNDKGVKIMLNTSVKDI------KIKNDGVHSVILk-NGLEL 152 Clostridium tetani
2GQF_A 156 QCKNLIVATGGLSXPGLGATPFGYQIAEQFGIPVIPPRASLVPFTYReTDKF-LTALSGISLPVTIT------ALCGKSF 228 Haemophilus influenzae
Q6AII4 156 SCSRVVIATGGLSYPKTGSTGDGFSFSEELGHTVVPPRPALVPLTSK-DSFI--PEISGLDLRNVQAqll-vdNKKVASH 231 Desulfotalea psychrop...
Q9AAG2 170 RARVTILALGGASWPKLGSDAAWAPLLRVGGSEIAPFRPANCGFDVA-WSTMfRDRFAGEPLKNIALr------lGEARA 242 Caulobacter vibrioides
Q8XUM9 167 HADAVVLAMGGGSWPRLGSDGAWVPRLEARGVQVLPLKPANCGFDAD-WSAHfRERFAGQPVKSVAIgvasgdDGARQFR 245 Ralstonia solanacearum
Q88DQ8 161 KASVVVLALGGASWARLGSDGSWQPLLAERAVDISPLQPSNCGFEVAgWSALlKDKFAGAPLKNIALsv-----pGSAPR 235 Pseudomonas putida KT...
Q87W91 161 RPAATLLALGGASWARLGSDGAWLPWLQAQQVNVAPLQAANCGFEVSaWSDLlRSKFAGAPLKNIAMgl-----tGQALR 235 Pseudomonas syringae ...
Q89N81 157 AADATVLALGGASWPRLGSDGGWVDILAANGITISKLRPANSGFTVA-WSELfRDRFEGQPLKGVALt------iGAHTV 229 Bradyrhizobium japonicum
Q6N7R9 158 AARATVLALGGASWPRLGSDGSWSGLLAAKGITIAPLRPANCGFVAE-WSALfADKYQGAPLKNVALs------fGTRTV 230 Rhodopseudomonas palu...
Q8XLT7 155 LGDKIIITTGGKSFPNTGSDGEMYSILEKYGHTITPIHAALIPLVTK-EDFV--KNLQGVAMKDVVVsa--kiKKKKYEK 229 Clostridium perfringens
Q895F9 153 QGDYFIIATGGASYPQTGSTGDGYKFASKAGHRIITIKPALVPLEIK-NQWV--KNLQGLSLKNVELkiinnkSKELYKD 229 Clostridium tetani
2GQF_A 229 YNQLLFTHRGISGPAVLQISNYW------QPTESVEIDLLPNHN---VEEEINQAKQSSPKQXLKTILVRLLPKKLVELW 299 Haemophilus influenzae
Q6AII4 232 FGEISFTTFGVAGPIGIGLSGQAidalhkKQSVQIHIDLKPALDyqkLDARLIRDLTTNYKDTIKTILRGLLPQKLIALC 311 Desulfotalea psychrop...
Q9AAG2 243 RGDAVIARYGLEGGAIYALGGAArda-alAGGATLTVDLRPDIPvetLERRLHAPRGGQS-------LANFLRKAVKLSP 314 Caulobacter vibrioides
Q8XUM9 246 PGEFLVTQSGIEGSLVYALSAPIrdaleaGGEITIWLDLAPGWSaqrVADALMRPRGARS-------MSSHLQSKLNITG 318 Ralstonia solanacearum
Q88DQ8 236 KGEFILTAQGVEGSLVYAWSAPVreaihrEGRGVLLLDLLPDKPvdkIAQALAKPRGSRS-------MAKHLHSQLGIDG 308 Pseudomonas putida KT...
Q87W91 236 LGECVLTETGVEGSLVYALSAQIreqinlQGSAVVHIDLLPGKAlpdVQKALNKPRGSRS-------MAKHLHSQLGLDG 308 Pseudomonas syringae ...
Q89N81 230 RGEAMITRGGIEGGAIYALSAELreavlgIGQAMLTIALRPDLAaaaLTTRLSGTRGKQS-------LANFLRKAAQVSP 302 Bradyrhizobium japonicum
Q6N7R9 231 RGEAVITREGIEGGAIYAISALLrdailaNGEAKLSIALRPDLTaddLVARLAKPKGKQS-------LSTYLRKTAGLPP 303 Rhodopseudomonas palu...
Q8XLT7 230 FGDMIFTHFGVSGPAILKLSSYItka-ldQGEVELNLDFLSDKSkeeLSQIIRSN----TNKTVLNNLKGTLPQNFLKQI 304 Clostridium perfringens
Q895F9 230 FGEMLFTHFGISGPIVLSASRYVk----eNEPQYAVLNLKPALTseeLDKRIQKDFSKYINKDFRNSLNDLLPKKLIDII 305 Clostridium tetani
2GQF_A 300 IEQ--GiVQDEV-IANISKVRVKNLVDFIHHWEFTPNGTEGYRTAEVTXGGVDTKVISSKTXESNQVSGLYFIGEVLDVT 376 Haemophilus influenzae
Q6AII4 312 LHDcqI-APQTA-AGTFPAAMRKKIVHWLKNFTVTINGHRSYDEAIITAGGVSLKEVSPKTMGSKKITGLYFAGEVLDLN 389 Desulfotalea psychrop...
Q9AAG2 315 VEVnlLrEA----HGLDLPVEPAALAAAIKAAPIRLTGVQPLDRAISSAGGVRFESLDGLTL--KGRPDVLLAGEMLDWE 388 Caulobacter vibrioides
Q8XUM9 319 VKLglLrEC----LSKDAFADLAQLAQAIKALPLRLTRARPIDEAISSAGGVAFEALDANLM-IARLPGVFCAGEMLDWE 393 Ralstonia solanacearum
Q88DQ8 309 VKAalLrEL----TDQATFADVDALARAIKALPITLVRTRPLDEAISSAGGVRFEGLDEGLM-VKGMPGVFCAGEMLDWE 383 Pseudomonas putida KT...
Q87W91 309 AKAalLrEL----APREAFADPLLLSEAIKALPLNLIKPRPIDEAISTAGGVTFEAMDERLM-LKQLPGVFCAGEMLDWE 383 Pseudomonas syringae ...
Q89N81 303 VGIglMqEAAIAsGRPLASFSPAELAHLINAIPVQLTGVAPIDRAISTAGGVSFDELDADFM-IRKLPGVFAAGEMLDWE 381 Bradyrhizobium japonicum
Q6N7R9 304 AGIglLqEAAHVsGVALATLPPDQLAALINAVPVRLVGTAPIEKAISTAGGIALDEIDANYM-LHKLPGVFAAGEMLDWE 382 Rhodopseudomonas palu...
Q8XLT7 305 FEVlgL-TE-IK-ASDLKKEDENKIISYIKEMKLTVRETLTIKAAQVTSGGVKVKEINASTMESKIIKNLYFAGEVIDID 381 Clostridium perfringens
Q895F9 306 VELsnI-PEDKK-VNSITKEERKNLCNLIQNLKMEIKGFRSIKEAIITSGGVHIDEINPSNMQSKIIPNLYFAGEVIDVD 383 Clostridium tetani
2GQF_A 377 GWLGGYNFQWAWSSAYACALS 397 Haemophilus influenzae
Q6AII4 390 ADTGGYNLQAAFSTGWLAGKS 410 Desulfotalea psychrophila
Q9AAG2 389 APTGGYLLQACFATGVAAGRA 409 Caulobacter vibrioides
Q8XUM9 394 APTGGYLLTACFASGAAAGHG 414 Ralstonia solanacearum
Q88DQ8 384 APTGGYLLTACFASGLRAGRA 404 Pseudomonas putida KT2440
Q87W91 384 APTGGYLLTACFASGRAAGLG 404 Pseudomonas syringae pv. tomato
Q89N81 382 APTGGYLLQASFATGAAAGRG 402 Bradyrhizobium japonicum
Q6N7R9 383 APTGGYLLTACFATGAEAGRG 403 Rhodopseudomonas palustris
Q8XLT7 382 AETGGYNLQMAFSTGYLAGSD 402 Clostridium perfringens
Q895F9 384 GYTGGFNIQIAFSTGYLAGTM 404 Clostridium tetani
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap