3VMF,3MCA,3E20,4AF1,2VGM


Conserved Protein Domain Family
eRF1_2

?
pfam03464: eRF1_2 
Click on image for an interactive view with Cn3D
eRF1 domain 2
The release factor eRF1 terminates protein biosynthesis by recognising stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre. The crystal structure of human eRF1 is known. The overall shape and dimensions of eRF1 resemble a tRNA molecule with domains 1, 2, and 3 of eRF1 corresponding to the anticodon loop, aminoacyl acceptor stem, and T stem of a tRNA molecule, respectively. The position of the essential GGQ motif at an exposed tip of domain 2 suggests that the Gln residue coordinates a water molecule to mediate the hydrolytic activity at the peptidyl transferase centre. A conserved groove on domain 1, 80 A from the GGQ motif, is proposed to form the codon recognition site. This family also includes other proteins for which the precise molecular function is unknown. Many of them are from Archaebacteria. These proteins may also be involved in translation termination but this awaits experimental verification.
Statistics
?
PSSM-Id: 308849
View PSSM: pfam03464
Aligned: 23 rows
Threshold Bit Score: 118.929
Threshold Setting Gi: 223635645
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3VMF_B 142 AIGIIIVERDQATIGLLKGARLEVLKELEGFVPGKHKMGGQSQRRYERIIEQMVDEFFKKVGEEASNLLVpLaEKGVLKG 221 Aeropyrum pernix K1
O26964 141 TYGLAVLDRKEATIATLKGKRIDILKTLTSGVPGKHKAGGQSQRRFDRLIDLAAHEFLKRIGEHMNEAFL---QIDDLKG 217 Methanothermobacter t...
Q58239 141 AYGVILVDRNEATIALVKGRNINILKKLTSGVPGKFKAGGQSARRLERLIDLAAHEFLQRVGQKANEQFLpLlQEKKLRG 220 Methanocaldococcus ja...
O27679 136 KAIILVMEDDVAELGLIRQYGVEYRGPITGHIPGKRI---QQRD-----RGKLRREFYESIVESLQKY-------GDLET 200 Methanothermobacter t...
Q9ZT87 136 DLAVVLMQEGLAQIFLVGRSVTSSRARIETSIPRKHGP---AIAGYE--------SALKKFFENVLQAFVkHvDFSVVRC 204 thale cress
P50444 136 DVAAVVLHEGLANVCLITPAMTLTRAKIDMTIPRKR-KGFTSQH----------EKGLEKFYEAVSTAFMrHvNLQVVKC 204 Caenorhabditis elegans
Q9BRX2 136 DVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRK-GNCSQH------DRALERFYEQVVQAIQRHi----HFDVVKC 204 human
P48612 136 DVAAVVMQEGLAHVCLITASMTLVRSKIEVSIPRKRK-GSVQQH------EKGLAKFYEQVMQSILRHv----NFDVVKC 204 fruit fly
3MCA_B 136 EIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKR-RGDSSAYQ------KGLDKFYDSVFQSINSEf----DFDKLKV 204 fission yeast
Q5JGK6 139 aYGLITVEKNEATIGLLRGKRIEVIDELTSNVPGKTRAGGQSARRYERIREQETHEFMKRIGEHANKAFLpLlEKGELRG 218 Thermococcus kodakare...
3VMF_B 222 VIVAGPGLAKQEFVEGNYLDYRLKk--------ILAPeLVDVAYQGLQGLKEAVMK--AEKVVEA 276 Aeropyrum pernix K1
O26964 218 IILGGPGHTKEEFLNGDYLHHELKk--------KVIT-TVDTSYTGEFGIREVIDK--SMDVLSE 271 Methanothermobacter thermautotrophic...
Q58239 221 ILVGGPGHTKNEFVEGDYLHHELKk--------IVLD-TFDLCYTEEFGIRELLEK--AAPLLKD 274 Methanocaldococcus jannaschii DSM 2661
O27679 201 IIIAGPGFYKSDFYDYLMERYPEIa--------KKAV-LENTGTGGRAGISEVLRKgtVERVSSE 256 Methanothermobacter thermautotrophic...
Q9ZT87 205 AVVASPGFTKDQFHRHLLLEAERRqlrpiienkSRII-LVHTNSGYRHSLGEVLHApnVMNMIKD 268 thale cress
P50444 205 VIVASRGFVKDAFMQHLIAHADANgkkftteqrAKFM-LTHSSSGFKHALKEVLETpqVALRLAD 268 Caenorhabditis elegans
Q9BRX2 205 ILVASPGFVREQFCDYLFQQAVKTdnklllenrSKFL-QVHASSGHKYSLKEALCDptVASRLSD 268 human
P48612 205 VLIASPGFVRDQFYDYMFQQAVKMdykllldnkSKFM-LVHASSGFKHSLREILQDpaVLAKMSD 268 fruit fly
3MCA_B 205 VILASPGFVARGLYDYIFSMAVKLdlkqivkskNKFV-ILHSSTGHIHSLNEILKDpaVESKLAD 268 fission yeast
Q5JGK6 219 IIIGGPGPTKEEFVEGDYLHHELRk--------KVIG-VVDISYHGEYGLRELVEK--ASDILKD 272 Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap