Conserved Protein Domain Family
RP-C

?
pfam03428: RP-C 
Replication protein C N-terminal domain
Replication protein C is involved in the early stages of viral DNA replication.
Statistics
?
PSSM-Id: 335321
View PSSM: pfam03428
Aligned: 51 rows
Threshold Bit Score: 140.824
Threshold Setting Gi: 760070810
Created: 25-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123545413  14 RMSFALLAAQKKARQI---P-QGaaADKWQLHRWLCEAKTILGINDRSLAVLSALLSFYPEVTLTGEGNLVVFPSNKQLA 89
gi 81354389   21 RISEAMLAARDELTTPvpaE-----PGKRDMLNMLKSLRGVLPVSRGAASTLIIMVEKTSPDAWTALETPFIYAHNTTLM 95
gi 123751910  12 RVTPGIAASARLAMANdipD-----TTKSEMALLLKKAAPVLGIDGTTYHVMDILLGLSQADDWKGSGRPIVAISNAKLA 86
gi 182636603  16 RISPAMLAFRETADTYqglP-DGs-LKPFQFLTAFQQALPYLRLPPKAFELVAWLFDMTHACDWQQGSKPIAWPSARLQQ 93
gi 515109440  16 RITAAMILAEMQCEALpr---sG--ASKTQILSALHTEPRALGLQPRQSDLLGFLISRTKPVDWEDDNLIICAVRNRDIC 90
gi 939009371  11 KMTPGMLESQRLAMANdivK-----TTKAEVAITLKKAAPAMGIDGTAYHILDILIGLTRADDWKQDRRPLVAISNEKLA 85
gi 754138616  12 KLTPAMVASQKLAMANdivK-----TTKSEVAMALKKAAPALGIDGTTYHILDILIGLTAAEDWSQDRRPLVAISNEKLA 86
gi 501838879  14 RMTKERAEFRRLAQSTevgT-----VTRGQLAVLSQSLPCTGLITSTESHLLTVIVNTARADAFDTGGRPIVFKSNNQLG 88
gi 500738116  14 KQTPQRTEFRRLAQTAeigM-----VTRGQLIRLAQSLPCLGLINGTEAHLLVVLINTAPAESYDKGGRPIVFKSNAALA 88
gi 501236470  13 rlAGPQWEAARLAQSYvglPeG---ISKAMLLDRFERAASRLGISDGVVRLMRALVRVTYEQDWTGKTRPIAWPSNDALG 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123545413  90 lRAHGMADATLRRHLAALVEAGLIARQDSPNGKRYARRAKG-GELQIAFGFSLAPLLARAPEFEAAAEEIKTAKAQLREM 168
gi 81354389   96 -SWTGLSRSTLQRHIRELADARLLVPQDGRNGQRGRRWQTEeGQTQ--VGFNLASLRYRWPDLLALSAE-------QRRL 165
gi 123751910  87 -EYTLRSQRTVMRCIRRLVEAGVAAYRDSSTGRRFVYRNDK-GEVTAGFGIDFTPSRVRAGELKQAVIQYHQQLNAELAA 164
gi 182636603  94 -EYLGLSAARVKVLNRALFEAGIFVIRDNAEGKRYGQRGPD-GRILQAFGFDLSPLAQRYAEFLRIAEEAKIERALVRSC 171
gi 515109440  91 -ERFGIERSTVKRWLRGLSELGWIIMRDSPNQQRWLRRDGRnGAILEGYGFDLSPLSRRYDEMLQRVEAFREREREGKRL 169
gi 939009371  86 -EYVCRSTRTVIRALKRLVEAGILAYRDSSTGRRFIYRNDAsGEIDRGYGFDFSPARQRVAEIKQIGDAFQARLRAEQEA 164
gi 754138616  87 -EYVSRSSRTVVRSLRRLVEAGVLAYKDSPTGRRYIYRAGEdRQIERGYGLDFSPARQRLDELKQIGAEFAARLAQEKEA 165
gi 501838879  89 -FEINRSPGRVSRILSRLFDAGLVTMQDSANFKRYPIRDGE-GELSDACGIDLRVLIARYRELDALVRQKREEKRANDAA 166
gi 500738116  89 -FEIGRSEGRVSRVLSRLFDAGVITMQDSGNYKRYPVRDGD-ASIADACGIDLRVLIARFAELDGMVRQAKAEKKALNAN 166
gi 501236470  90 -QELQRSRAAIQRLIRAAVCAGLVHMKDSGNGKRYGYRGER-GEIVEAYGFDLSPLAVRWDEFADLAAARGLEEARRRDL 167
                        170
                 ....*....|....*....
gi 123545413 169 REQLTLLRRDIAKLIEFAL 187
gi 81354389  166 RQRVSFLRDNIASLNDTVR 184
gi 123751910 165 KRDISRLSRAIEDLCLSNp 183
gi 182636603 172 RRQLTLVRKAILQAeailk 190
gi 515109440 170 HKRAMILSRRITALSATAL 188
gi 939009371 165 KRTVNRLSRAIVDACRTGQ 183
gi 754138616 166 KRTVSRLSRAMTDLFRLAA 184
gi 501838879 167 ARRFRAALRSARFALmnaa 185
gi 500738116 167 LRRYRGAVRNLRYALASMe 185
gi 501236470 168 KRRLGELRREIRTVCADAL 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap