Conserved Protein Domain Family
RP-C

?
pfam03428: RP-C 
Replication protein C N-terminal domain
Replication protein C is involved in the early stages of viral DNA replication.
Statistics
?
Aligned: 51 rows
Threshold Bit Score: 137.718
Threshold Setting Gi: 219952370
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCD31929            13 PLSLAMVEVQATTRDFaakPdasetvVHKWRLFRALTEAKGPLGVTDRALSVLHALLSFHQETALTlPEGdggdgegdsp 92  Methylocy...
jgi:Dshi_3743        8 KPTPGLGIAEQLAQAGervA------VPKTRAFVALKRVGAHIGLKAGDMMLLDTLGAFTQAQDWE-EGQ---------- 70  Dinoroseo...
Q07GS3               8 KPTPGLVAAEKLAQAGehlS------IPKTRAIVAAKKVAAAIGLKSQDLLLLDTFGAVTQPQDWE-QGK---------- 70  Roseobact...
Q5HXT6              21 RISEAMLAARDELTTPvpaE------PGKRDMLNMLKSLRGVLPVSRGAASTLIIMVEKTSPDAWT-ALE---------- 83  Gluconoba...
BAI00851            14 KITPAMVAARTTAEALplqA------VEMSDLYRYLRQGRSILGLTCQQTELLCYLIAFTQPADWSgEDDv--------- 78  Acetobact...
jgi:Oant_4539       14 KQTPQRTEFRRLAQTAeigM------VTRGQLIRLAQSLPCLGLINGTEAHLLVVLINTAPAESYD-KGG---------- 76  Ochrobact...
vbi:Avi_9901        14 RMTKERAEFRRLAQSTevgT------VTRGQLAVLSQSLPCTGLITSTESHLLTVIVNTARADAFD-TGG---------- 76  Agrobacte...
AGO_pseu:PSEp_0283  17 KLTPAMVASQKLAMANdivK------TTKSEVAMALKKAAPALGIDGTTYHILDILIGLTAAEDWS-QDR---------- 79  Pseudovib...
AGO_pseu:PSE_2020   11 KMTPGMLESQRLAMANdivK------TTKAEVAITLKKAAPAMGIDGTAYHILDILIGLTRADDWK-QDR---------- 73  Pseudovib...
Q2K2C8              12 RVTPGIAASARLAMANdipD------TTKSEMALLLKKAAPVLGIDGTTYHVMDILLGLSQADDWK-GSG---------- 74  Rhizobium...
CCD31929            93 apGIVVFPSNRELSiRAHGMAPATLRRHLASLVEAGLIIRRDSPNGKRFARRGKG-GEIAEAFGFDLAPLIARAAEIENL 171 Methylocy...
jgi:Dshi_3743       71 --RPIVWASNAYLM-EQTGFSLSALKRHARRLAENGVISFQDSPNGKRWGRRDAE-GRIVEAYGFDLSPLSARVEEFEEL 146 Dinoroseo...
Q07GS3              71 --RPIVWASNNFLM-EQTGFSLATLKRHARRLCEAGLIAFKDSPNGKRYGRRDED-GVIVEAYGFDLAPLAARTVEFEAL 146 Roseobact...
Q5HXT6              84 --TPFIYAHNTTLM-SWTGLSRSTLQRHIRELADARLLVPQDGRNGQRGRRWQTEeGQTQ--VGFNLASLRYRWPDLLAL 158 Gluconoba...
BAI00851            79 --LPVSTASNLDIQ-QRFDLGRTRVKNLLRELAEAGWLLHRDSPNGQRYRRSNPFtPRSQQAYGFDLSPLARRFDDLKRA 155 Acetobact...
jgi:Oant_4539       77 --RPIVFKSNAALA-FEIGRSEGRVSRVLSRLFDAGVITMQDSGNYKRYPVRDGD-ASIADACGIDLRVLIARFAELDGM 152 Ochrobact...
vbi:Avi_9901        77 --RPIVFKSNNQLG-FEINRSPGRVSRILSRLFDAGLVTMQDSANFKRYPIRDGE-GELSDACGIDLRVLIARYRELDAL 152 Agrobacte...
AGO_pseu:PSEp_0283  80 --RPLVAISNEKLA-EYVSRSSRTVVRSLRRLVEAGVLAYKDSPTGRRYIYRAGEdRQIERGYGLDFSPARQRLDELKQI 156 Pseudovib...
AGO_pseu:PSE_2020   74 --RPLVAISNEKLA-EYVCRSTRTVIRALKRLVEAGILAYRDSSTGRRFIYRNDAsGEIDRGYGFDFSPARQRVAEIKQI 150 Pseudovib...
Q2K2C8              75 --RPIVAISNAKLA-EYTLRSQRTVMRCIRRLVEAGVAAYRDSSTGRRFVYRNDK-GEVTAGFGIDFTPSRVRAGELKQA 150 Rhizobium...
CCD31929           172 AEEVRVENRAIALLREKITLLRRDIAKMIETGM 204 Methylocystis sp. SC2
jgi:Dshi_3743      147 QAELQAERELCQRLKRQITVARRIIRARIEAAV 179 Dinoroseobacter shibae DFL 12 = DSM 16493
Q07GS3             147 HAQLLEERQLCKSLRNTITVMRRVIRAKIEKAL 179 Roseobacter denitrificans OCh 114
Q5HXT6             159 SAE-------QRRLRQRVSFLRDNIASLNDTVR 184 Gluconobacter oxydans
BAI00851           156 AETALWRQQEGRRLHREVTTLSRTIYALFQTAE 188 Acetobacter pasteurianus IFO 3283-01
jgi:Oant_4539      153 VRQAKAEKKALNANLRRYRGAVRNLRYALASMe 185 Ochrobactrum anthropi ATCC 49188
vbi:Avi_9901       153 VRQKREEKRANDAAARRFRAALRSARFALmnaa 185 Agrobacterium vitis S4
AGO_pseu:PSEp_0283 157 GAEFAARLAQEKEAKRTVSRLSRAMTDLFRLAA 189 Pseudovibrio sp. FO-BEG1
AGO_pseu:PSE_2020  151 GDAFQARLRAEQEAKRTVNRLSRAIVDACRTGQ 183 Pseudovibrio sp. FO-BEG1
Q2K2C8             151 VIQYHQQLNAELAAKRDISRLSRAIEDLCLSNp 183 Rhizobium etli CFN 42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap