Conserved Protein Domain Family
RP-C

?
pfam03428: RP-C 
Replication protein C N-terminal domain
Replication protein C is involved in the early stages of viral DNA replication.
Statistics
?
PSSM-Id: 335321
View PSSM: pfam03428
Aligned: 51 rows
Threshold Bit Score: 140.824
Threshold Setting Gi: 760070810
Created: 25-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2YIS0        14 RMSFALLAAQKKARQI---P-QGaaADKWQLHRWLCEAKTILGINDRSLAVLSALLSFYPEVTLTGEGNLVVFPSNKQLA 89  Brucella abortu...
Q5HXT6        21 RISEAMLAARDELTTPvpaE-----PGKRDMLNMLKSLRGVLPVSRGAASTLIIMVEKTSPDAWTALETPFIYAHNTTLM 95  Gluconobacter o...
Q2K2C8        12 RVTPGIAASARLAMANdipD-----TTKSEMALLLKKAAPVLGIDGTTYHVMDILLGLSQADDWKGSGRPIVAISNAKLA 86  Rhizobium etli ...
ACB97376      16 RISPAMLAFRETADTYqglP-DGs-LKPFQFLTAFQQALPYLRLPPKAFELVAWLFDMTHACDWQQGSKPIAWPSARLQQ 93  Beijerinckia in...
WP_016738523  16 RITAAMILAEMQCEALpr---sG--ASKTQILSALHTEPRALGLQPRQSDLLGFLISRTKPVDWEDDNLIICAVRNRDIC 90  Gluconobacter o...
WP_054783693  11 KMTPGMLESQRLAMANdivK-----TTKAEVAITLKKAAPAMGIDGTAYHILDILIGLTRADDWKQDRRPLVAISNEKLA 85  Pseudovibrio de...
WP_041769239  12 KLTPAMVASQKLAMANdivK-----TTKSEVAMALKKAAPALGIDGTTYHILDILIGLTAAEDWSQDRRPLVAISNEKLA 86  Pseudovibrio sp...
WP_012653079  14 RMTKERAEFRRLAQSTevgT-----VTRGQLAVLSQSLPCTGLITSTESHLLTVIVNTARADAFDTGGRPIVFKSNNQLG 88  Agrobacterium v...
WP_011982873  14 KQTPQRTEFRRLAQTAeigM-----VTRGQLIRLAQSLPCLGLINGTEAHLLVVLINTAPAESYDKGGRPIVFKSNAALA 88  Ochrobactrum an...
WP_012279488  13 rlAGPQWEAARLAQSYvglPeG---ISKAMLLDRFERAASRLGISDGVVRLMRALVRVTYEQDWTGKTRPIAWPSNDALG 89  Caulobacter sp....
Q2YIS0        90 lRAHGMADATLRRHLAALVEAGLIARQDSPNGKRYARRAKG-GELQIAFGFSLAPLLARAPEFEAAAEEIKTAKAQLREM 168 Brucella abortu...
Q5HXT6        96 -SWTGLSRSTLQRHIRELADARLLVPQDGRNGQRGRRWQTEeGQTQ--VGFNLASLRYRWPDLLALSAE-------QRRL 165 Gluconobacter o...
Q2K2C8        87 -EYTLRSQRTVMRCIRRLVEAGVAAYRDSSTGRRFVYRNDK-GEVTAGFGIDFTPSRVRAGELKQAVIQYHQQLNAELAA 164 Rhizobium etli ...
ACB97376      94 -EYLGLSAARVKVLNRALFEAGIFVIRDNAEGKRYGQRGPD-GRILQAFGFDLSPLAQRYAEFLRIAEEAKIERALVRSC 171 Beijerinckia in...
WP_016738523  91 -ERFGIERSTVKRWLRGLSELGWIIMRDSPNQQRWLRRDGRnGAILEGYGFDLSPLSRRYDEMLQRVEAFREREREGKRL 169 Gluconobacter o...
WP_054783693  86 -EYVCRSTRTVIRALKRLVEAGILAYRDSSTGRRFIYRNDAsGEIDRGYGFDFSPARQRVAEIKQIGDAFQARLRAEQEA 164 Pseudovibrio de...
WP_041769239  87 -EYVSRSSRTVVRSLRRLVEAGVLAYKDSPTGRRYIYRAGEdRQIERGYGLDFSPARQRLDELKQIGAEFAARLAQEKEA 165 Pseudovibrio sp...
WP_012653079  89 -FEINRSPGRVSRILSRLFDAGLVTMQDSANFKRYPIRDGE-GELSDACGIDLRVLIARYRELDALVRQKREEKRANDAA 166 Agrobacterium v...
WP_011982873  89 -FEIGRSEGRVSRVLSRLFDAGVITMQDSGNYKRYPVRDGD-ASIADACGIDLRVLIARFAELDGMVRQAKAEKKALNAN 166 Ochrobactrum an...
WP_012279488  90 -QELQRSRAAIQRLIRAAVCAGLVHMKDSGNGKRYGYRGER-GEIVEAYGFDLSPLAVRWDEFADLAAARGLEEARRRDL 167 Caulobacter sp....
Q2YIS0       169 REQLTLLRRDIAKLIEFAL 187 Brucella abortus 2308
Q5HXT6       166 RQRVSFLRDNIASLNDTVR 184 Gluconobacter oxydans
Q2K2C8       165 KRDISRLSRAIEDLCLSNp 183 Rhizobium etli CFN 42
ACB97376     172 RRQLTLVRKAILQAeailk 190 Beijerinckia indica subsp. indica ATCC 9039
WP_016738523 170 HKRAMILSRRITALSATAL 188 Gluconobacter oxydans
WP_054783693 165 KRTVNRLSRAIVDACRTGQ 183 Pseudovibrio denitrificans
WP_041769239 166 KRTVSRLSRAMTDLFRLAA 184 Pseudovibrio sp. FO-BEG1
WP_012653079 167 ARRFRAALRSARFALmnaa 185 Agrobacterium vitis
WP_011982873 167 LRRYRGAVRNLRYALASMe 185 Ochrobactrum anthropi
WP_012279488 168 KRRLGELRREIRTVCADAL 186 Caulobacter sp. K31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap