5G5P


Conserved Protein Domain Family
SAC3_GANP

?
pfam03399: SAC3_GANP 
Click on image for an interactive view with Cn3D
SAC3/GANP family
This family includes diverse proteins involved in large complexes. The alignment contains one highly conserved negatively charged residue and one highly conserved positively charged residue that are probably important for the function of these proteins. The family includes the yeast nuclear export factor Sac3, and mammalian GANP/MCM3-associated proteins, which facilitate the nuclear localization of MCM3, a protein that associates with chromatin in the G1 phase of the cell-cycle.
Statistics
?
PSSM-Id: 335312
View PSSM: pfam03399
Aligned: 136 rows
Threshold Bit Score: 204.669
Threshold Setting Gi: 209880329
Created: 22-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5G5P_A       198 GTCLDMCPTFERSRRNVEYTVYSYEk----nQpND---KKASRTKALKVFAR-PAAAAAPPLPSDVRPPHILVKTLDYIV 269 baker's yeast
XP_007234731  34 GTCSTMCPNSEVWQREAQNRLHRFEmlagteRdRL---PRADVTRVVKEYSR-PAAGKDTTRASELRPPDVLLKTVCYLV 109 Mexican tetra
XP_007070464  10 GTCPGMCPLGELAQRERQGWLHRLEl-----ReGT---RQGDPARVVKEYSR-PAAGKELPRPQELRPAPVLLATVHYLL 80  green sea turtle
XP_784962     34 GECKDMCPLKEQKERERQRRLHFLEivagteRdRC---PKVDHSLAIKEYSR-PAAGKEEANPSDLRPPHVLLKVVNHIV 109 purple sea urchin
NP_001291212   9 GTCLDMCPAAERAQREKERRLHRFEvvp-gcRrDR---PRADPQRAVKEYSR-PAAGKNRPPPSQLRPPSVLLATVRYLA 83  cattle
XP_008122120  21 GTCPGMCPASEFDRRKCQRRLHRLEl----gPsPS---CQPDASLAVKEYSR-PAAGKPPPRPEELRPPPVLLDTVRHLL 92  green anole
EDM12574      91 GLCPDMCPAAERARRERERRLHRLEv----ePgGCgnaPRADPRRTVKEYSR-PAAGKPRPPPSLLRPPPVLLATVRYLA 165 Norway rat
XP_002141604   5 GRCTKFCPLEEEKSRIYLKRLSIFE------QkDN---FPGEMIFIVKEYIR-LS--TSTINLNNIRDIDTLKSVSNYLL 72  Cryptosporidium...
XP_010597471   9 GTCSDMCPAAERAQREKERRLHRFEvvp-gcRgDQ---PRADLQRA-REGVQsPAAGKPRPSPSQLRPPRVLLAAVRYLA 83  African savanna...
XP_011613126  55 GSCLTMCSVGELRERERQKRLHRFEmmpgteRdRL---PRGDPLRAVKEYTR-PAAGKDSTNPAELRPAEVLLKTVCYLI 130 torafugu
5G5P_A       270 -----DNLLt-----tLPESEGFLWDRMRSIRQDFTYQNYSGPEA-VDCNERIVRIHLLILHIMVKSn--vE-F-SLQQE 334 baker's yeast
XP_007234731 110 -----DDIAanpklqpWTEVYSFVFDRLRSVRQDMVIQRISGPDC-ASVLERTVRFLLYASYHLCGQpl-rL-Y-DPHIN 180 Mexican tetra
XP_007070464  81 -----GQVApra-dlpPPEVHAFISDRLRAVHQDATLQRLRGAPC-VALLERSLGYLLHAGYQLCREpp-aR-F-DPHLH 150 green sea turtle
XP_784962    110 -----QNVLtrn-dlpWFKVYNFAFDRLRAVRQDLVIQRASGFEC-ALILEQCVRFHIYSAYKLCAApl-sE-F-VPKIN 179 purple sea urchin
NP_001291212  84 -----SEVAert-dasCAEVASFVADRLRAVRLDLALQTASDVET-ALVLESALAVLLAVVARLGPNat-hGpV-DPMLL 154 cattle
XP_008122120  93 -----S-LDdga-kgdEAERCAFVTDRLRAVRLDLTLQRLTSRPCaIPILERALVFLLHAGSRLHAQpd-sR-F-DAHLH 162 green anole
EDM12574     166 -----GEVAdrt-dvsCAEVASFVADRLRAVRLDLSLQGVDDAEA-AAVLEPALATLLVVVARMRPEet-rG-VaDPVLL 236 Norway rat
XP_002141604  73 iqlfpKVIIkgs-nemKSQIFEFINNRLRAIRQDATVQHCISIEF-LKILVQSIRFHLLTEYLACNKii-yL-S-SFNWN 147 Cryptosporidium...
XP_010597471  84 -----GEVAera-dasRAEVASFVADRLRAVRLDLALQSAGDAEA-AVVLETALATLLAVVARLGPDaargA-V-DPGLL 154 African savanna...
XP_011613126 131 -----DDIAassrphpWTEVYSFVFDRLRGVKQDMIIQRISGLNC-VAILERMVRFLIYSSYRLCGEpp-hL-Y-NPCIN 201 torafugu
5G5P_A       335 LEQLHKSLITLSEI-------------YDDV--Rss------ggTCPNEAEFRAYALLSKIRDP----QYDENIQ-RLPK 388 baker's yeast
XP_007234731 181 DTHLQESLSWLLEC-------------YAEG-------------QHKHQDEFQALSLLYNLGSP----QATQHAL-ALPH 229 Mexican tetra
XP_007070464 151 RTQLQECFSWLRRC-------------YRDS--Chh-----------gEPAFQALFLLYNLGFP----EALRQVL-QLPD 199 green sea turtle
XP_784962    180 SDHTSECLKRLLYI-------------YQLQ--RqeedgecdetQRDAQIQMESCHVIFSLGSF----NALFHVL-SLPK 239 purple sea urchin
NP_001291212 155 QAQVQESFGSLRRC-------------YALG--Ag---------PHPRQATFQGLFLLYNLGSV----EALHEIL-RLPA 205 cattle
XP_008122120 163 REQVQESFAALRRA-------------YRQGqaKdq------gvAAASEPRFQALFLLYNLGSP----AALGQVL-HLPK 218 green anole
EDM12574     237 QTQVQEGFGSLRRC-------------YA----Rgk-------aPHPRQAAFQGLFLLYNLGSV----EALQEVL-QLPA 287 Norway rat
XP_002141604 148 RFLLGLCLMQALQI-------------YLKV--NkytcykqnpqLYELSSEIISYVVLISLSNRqkplNILDYLYfYVKH 212 Cryptosporidium...
XP_010597471 155 QAQVQEGFGSLRRCyargagphprqaaF------------------------QGLFLLYNLV-C----GGFARDL-QLPA 204 African savanna...
XP_011613126 202 DTHLQENLTWLLDC-------------YARE--Kg---------PYPNQEEFYALGLLYNLGLV----RPAQHIL-ELPK 252 torafugu
5G5P_A       389 HIFQDKLVQMALCFRRVISNsaytergfvktenclNFYARFFQLMQspSLPLLMGFFLQMHLTDIRFYALRALSHTLn-K 467 baker's yeast
XP_007234731 230 KVRTSPPVQLALAVSRAYME---------------RNPVRLLRLAQ--KLDFLQACALHRHLLSCRRDLLLLYNHGHs-S 291 Mexican tetra
XP_007070464 200 PVRASPELRTALAVNWAYLE---------------RNWARFFRLVQ--ALPYLPICALHRHLGPARRLALLTFSHGFs-T 261 green sea turtle
XP_784962    240 YIRFSPRLINAVALTKAFWE---------------GNFIRVKKLAA--RLSAIEMCCLHTHLQHIRSQALMTMNTAFs-S 301 purple sea urchin
NP_001291212 206 ALRSCPALRTALAVDSAFRE---------------GNAARLFRLLR--TLPYLQSCAVQCHVGRARRGALARLARALs-T 267 cattle
XP_008122120 219 GSRTSPDIVLALAIHWAFLE---------------RNFARFFRLAS--ALPYLPSCALQPHLVAARRQALATFSHGFs-A 280 green anole
EDM12574     288 ALRACPPLQTALAVDSAFRE---------------DNYARLFRLLR--TLPYLQSCAVQEHIGYARRKALSRLSRALs-T 349 Norway rat
XP_002141604 213 ELISHPICNITLNIAKEVLD---------------GNITRVLHLIT--KLPFFGKCAIISSITYLRNLYLDTFTTANs-N 274 Cryptosporidium...
XP_010597471 205 TLRAARPCAQP-GVDSAFRE---------------GNTARLFRLLR--TLSYLPSCAVCGHXGpCRRRALARLARALstP 266 African savanna...
XP_011613126 253 GLRSSPTITLALSINKAFLE---------------RNPVCVLRLAQ--RLDFLQSCALHRHLVACRRDLLLIYSHGYn-S 314 torafugu
5G5P_A       468 -KHKPIPFIYLENMLLFNNRQEIIEFCNYYSIEIIN 502 baker's yeast
XP_007234731 292 -KNCRFPIQKLADILSLE-QSLAVQLCQAHGIQINg 325 Mexican tetra
XP_007070464 262 -RNCRCPLAWLARLLAVDGPEEMAELCRHHGLMVLD 296 green sea turtle
XP_784962    302 -RNLLFPSRVITDWLMFDEVEEAEDFCHHFGLDVKD 336 purple sea urchin
NP_001291212 268 pKGQTLPLGFMVHLLALDGPNEARDLCQAHGLPLDg 303 cattle
XP_008122120 281 -RNCRYPLARLARMLALGGAEEAAQLCRAHGLTVVD 315 green anole
EDM12574     350 pRGQTLPLDFIVHLLALDGLQEAQDLCQAHGLTLDK 385 Norway rat
XP_002141604 275 gKGLKVTLSSLKTLLSFQNEDALIEYIKPTGLIISE 310 Cryptosporidium muris RN66
XP_010597471 267 -KGQTLPLGFLVHLLALDGPEEARDLCQAHGLPLDG 301 African savanna elephant
XP_011613126 315 -RNCRFPLDRLAQLLSLDA-SHAAQLCRAYGLEVTQ 348 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap