5Y6O


Conserved Protein Domain Family
Daxx

?
pfam03344: Daxx 
Click on image for an interactive view with Cn3D
Daxx N-terminal Rassf1C-interacting domain
The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis. Daxx forms a complex with Axin. Remodelling of the family to a short domain based on the Structure 2kzs structure gives a more representative family. DAXX is a scaffold protein shown to play diverse roles in transcription and cell cycle regulation. This N-terminal domain folds into a left-handed four-helix bundle (H1, H2, H4, H5) that binds to the N-terminal residues of the tumor-suppressor Rassf1C.
Statistics
?
Aligned: 12 rows
Threshold Bit Score: 166.485
Threshold Setting Gi: 556993676
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y6O_A         1 SSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINE 80  human
Q3UKR0        56 SSNSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNILSRVLARSRKRPAKIYVYINE 135 house mouse
XP_016835345  50 SRNSGGRKCYKLENERLFEEFLELCKVQTSDHPEVVPFLHKQQQRAQSLFLASAEFCNIMSRVLSRARNRPAKLYVYINE 129 Chinese hamster
Q5TJE1        50 SSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRAQSRPAKLYVYINE 129 dog
XP_023358680 121 sssggsKKCYQLENEKLFEEFLDLCKKQTGEHPEVVPFLCNRRQRARPTFLASAELRNVLSRVLSRAQSRPTKLYVYINE 200 Tasmanian devil
XP_006000988  52 SEKDAEKVILKAQNEKLFAEFVEFCSKLSDGHPEVISFLKGRHEKARPEYLASTEFRNVIGRCLTRVQNKKGKVFVYINE 131 coelacanth
AAI33997      55 ASAKKDTHVLKVENEKLFNEFVEHCSKHSQEHPEVMTYLQTRYSKALPTFLTSVEFRNTLGRCLTRAQANAGKTFVYINE 134 zebrafish
XP_007253142  47 STAKKEGHVLKVENEKLFGEFLEHCMVHTKEHPEVVTFLQTKYSKASPDFLMSVEFRNALGRCLTRAQASTTKTFVYINE 126 Mexican tetra
XP_025758073  62 ATAKKTTQCLQAENQKLFTEFVEHCRPLTEDCPEVLTFLQTKHSKACPDFLSSVELRNTLGRCLTRAQANRSKTFVYINE 141 Nile tilapia
XP_023133740  63 ASAKKDAHVLQAENQKLFTEFVEHCSGLTKDCPEVLTFLQTKHAKACPDYLSSVEFRNTLGRCLTRAQANLSKTFVYINE 142 clown anemonefish
CAF88249      84 VSARREPHVLQAENERLFGEFVDHCLADTTDCPEVLDYLKTRHAKASPEYLCSVEFRNTLGHCLSRAQAHRSKTFVYINE 163 spotted green p...
EHB06453      51 SSSSGGKKCYKLENEKLFEEFLELCKMQTSDHPEVVPFLCKLQQRAHSVFLASAEFCNILSRVLSRARSRPSKLYVYINE 130 naked mole-rat
5Y6O_A        81 LCTVLKAHSAKKKLN 95  human
Q3UKR0       136 LCTVLKAHSIKKKLN 150 house mouse
XP_016835345 130 LCTVLKAHSNKKKLN 144 Chinese hamster
Q5TJE1       130 LCTVLKAHSAKKKLN 144 dog
XP_023358680 201 LCTLLKAHSIKRKVP 215 Tasmanian devil
XP_006000988 132 VCTALKANSQKKKVP 146 coelacanth
AAI33997     135 LCTVLKQHTPRKRSS 149 zebrafish
XP_007253142 127 LCTLLKQHSAKRRAL 141 Mexican tetra
XP_025758073 142 LCTVLKQHAIKKRQT 156 Nile tilapia
XP_023133740 143 LCTVLRQHAIKRRQT 157 clown anemonefish
CAF88249     164 LCTVLTQHAAKKRQ- 177 spotted green pufferfish
EHB06453     131 LCTVLKAHSAKKKLN 145 naked mole-rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap