3MD0,2P67


Conserved Protein Domain Family
ArgK

?
pfam03308: ArgK 
Click on image for an interactive view with Cn3D
ArgK protein
The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Statistics
?
PSSM-Id: 281323
View PSSM: pfam03308
Aligned: 7 rows
Threshold Bit Score: 359.056
Threshold Setting Gi: 81551072
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MD0_A  47 LPRAITLVESTRPdhreQAQQLLLRLLPDSGNAHRVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAVDPSSTRTGGSI 126 Mycobacterium tubercu...
Q9RTL3  18 LARAVTLAEAGLP----SARPLLRAARERAGRATVLGVTGSPGSGKSTLTDALIAELRARGERVAVLAVDPSSPYSGGAI 93  Deinococcus radiodurans
Q9YBB4  19 LGRLLTLVENPGS----EAVELLERLSSRAGRAQVIGFTGIPGAGKSTLVSRVITGLRRRGYRVAVVAIDPTSPFSGGSI 94  Aeropyrum pernix
O28980  18 LARAITYVENEYP----ESKEIMRQIFAKTGRAHVVGLTGFPGVGKSTLVSKLTEEFRRRGKKVGIIAIDPGSPFTGGAL 93  Archaeoglobus fulgidu...
Q9RVG9  30 LAKAITLVESRRPaheqEAQALLTELLPHAGRSLRVGLTGVPGVGKSTLIEALGLFLADAGHRVAVLAVDPSSQRTGGSI 109 Deinococcus radiodurans
2P67_A  24 LAQAMTLVESRHPrhqaLSTQLLDAIMPYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVTGGSI 103 Escherichia coli K-12
P37895  22 LARAITLVESRRAdhqvAARTLLSRLMPLTGRAQRIGITGVPGAGKSTTIERFGCNLVEAGHRVAVLAVDPSSGRHGGSI 101 Caulobacter crescentu...
3MD0_A 127 LGDKTRMARLA------VHPNAYIRPSPTSGTLGGVTRATRETVVLLEAAGFDVILIETVGVGQSEVAVANMVDTFVLLT 200 Mycobacterium tubercu...
Q9RTL3  94 LGDRIRMLRHH------ADEGVFVRSLASRGALGGLSAQTLPVLALLDGAGFDWVILETVGVGQSEVDIAAVCDHTLLVL 167 Deinococcus radiodurans
Q9YBB4  95 MGDRLRMQEHA------ADPGVFIRSIPTRGIKGGLSMAALAMIEVFDAMGYDKIIIETVGVGQSEVDIINAAHTIIVVT 168 Aeropyrum pernix
O28980  94 LGDRLRLDGMDsrkqlwTDPGIFFRSMSSRGRAGGLAAKTGDVVRLLDAFGFDVILVETVGAGQSEVDIIEVADTSVVVM 173 Archaeoglobus fulgidu...
Q9RVG9 110 MGDKTRMPRLT------VHEGAFIRPSPSGGTLGGVARRTRETITLCEAAGYDVLLIETVGVGQSETQVAGMTDLFVLLT 183 Deinococcus radiodurans
2P67_A 104 LGDKTRMNDLA------RAEAAFIRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVARMVDCFISLQ 177 Escherichia coli K-12
P37895 102 LGDKTRMEQLS------VQANAFIRPSPSGGALGGVARKTREAMLLCEAAGFDVVIIETVGVGQSETVVADMVDIFLALL 175 Caulobacter crescentu...
3MD0_A 201 LARTGDQLQGIKKGVLELADIVVVNKADgehHKEARLAARELSAAIRLIYP---------------------R--EALWR 257 Mycobacterium tubercu...
Q9RTL3 168 TPAGGDGIQAFKAGIMEIADVIAVNKAD---LPGAERTVRELMAAQGLGWH---------------------D--EHTWF 221 Deinococcus radiodurans
Q9YBB4 169 MPGAGDDVQALKAGVMEIGDIYVVNKSD---KPEANKTAAYLQFALEKEDI---------------------GrrESGWR 224 Aeropyrum pernix
O28980 174 MPETGDEIQVNKAGILEIGDIYVVNKAD---LGGAEKVERWLRYMLSLDEEsvqmlsqmthadearvqsgefFerRKGWN 250 Archaeoglobus fulgidu...
Q9RVG9 184 LHGAGDELQGIKRGIMELADLCVVNKADt-nPRAAIRAQTELRSALTLLTP---------------------H--DAPWR 239 Deinococcus radiodurans
2P67_A 178 IAGGGDDLQGIKKGLMEVADLIVINKDDgdnHTNVAIARHMYESALHILRR---------------------K--YDEWQ 234 Escherichia coli K-12
P37895 176 IPGGGDELQGIKKGLIELADLLVINKADa-dPAKAERSARDYRNALHILTP---------------------A--HPDWT 231 Caulobacter crescentu...
3MD0_A 258 PPVLTMSAVEGRGLAELWDTVERHRQVLTGAGEFDARRRdQQVDWTWQLVRDAVLDRVWSNP 319 Mycobacterium tuberculosis H37Rv
Q9RTL3 222 APIRRTVASRGEGVDQIIEAVRQHREHLGETGLQGRRER-RAEFEVRTLVQERLLQRARAAG 282 Deinococcus radiodurans
Q9YBB4 225 PKLVKTSAVLGQGIDPLVDAIEEHWRFARNTGLHTEKVKaRRLLLAKMLAESLLSSKVSAAM 286 Aeropyrum pernix
O28980 251 PPVIKTVADRGEGIKELADAIEEHFDYMKKTGLIEKRRReRVKRELFEIVMNDVIKLVKEKT 312 Archaeoglobus fulgidus DSM 4304
Q9RVG9 240 PAALRASAVTGEGIPELWAKVQEYAETVDLA----AKRRaQTAVW-----FDDLCARRCGGP 292 Deinococcus radiodurans
2P67_A 235 PRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQqQSVEWLRKQTEEEVLNHLFANE 296 Escherichia coli K-12
P37895 232 PPVLTASGLTGQGLDVLWTQILRHREVMTANGARAARRAdQDARWMWAMVRDRLEDAFKTAP 293 Caulobacter crescentus CB15
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap