Conserved Protein Domain Family
Baculo_gp64

?
pfam03273: Baculo_gp64 
Baculovirus gp64 envelope glycoprotein family
This family includes the gp64 glycoprotein from baculovirus as well as other viruses.
Statistics
?
PSSM-Id: 281290
View PSSM: pfam03273
Aligned: 2 rows
Threshold Bit Score: 917.621
Threshold Setting Gi: 81947704
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P28977  18 D-CNTKTATGPYI---LDRYKPK-------PVTVSKKLYsatryttsaqNELLTAGYRTAWVAYCYNGGLVDSNTGCNAR 86  Thogoto virus (isolat...
Q8B9D4  39 EhCNAQMKTGPYKiknLDITPPKetlqkdvEITIVETDY----------NENVIIGYKGYYQAYAYNGGSLDPNTRVEET 108 Rachiplusia ou MNPV
P28977  87 LLHYPPSRDELLLWGSSHQCSYGDICHDCWGSDSYACLGQLDPAKHWAPRKELVRRDANWKFAYHMCNIDWRCGVTTSPV 166 Thogoto virus (isolat...
Q8B9D4 109 IKTLNVGKEDLLMWSIRQQCEVGEELIDRWGSDSDDCFRDNEGRGQWVKGKELVKRQNNNHFAHHTCNKSWRCGISTSKM 188 Rachiplusia ou MNPV
P28977 167 FFNL--QWVKNEVKVSTLLPNGS-------TVEHSAGeplfwtekdFSYLVKDNFEIQREEVKISCFVDPDywvgerktk 237 Thogoto virus (isolat...
Q8B9D4 189 YSRLecQDDTDECQVYILDAEGNpinvtvdTVLHRDG---------VSMILKQKSTFTTRQIKAACLLIKD--------- 250 Rachiplusia ou MNPV
P28977 238 kafcqDGTNFFEVTSHQFCHQYACYNFSKDEL---LEAVYKERAHEKSKDLPfgnKSW---------TVVTASIDDLHAL 305 Thogoto virus (isolat...
Q8B9D4 251 -----DKNNPDSITREHCLIDNDIYDLSKNTWnckFNRCIKRKVEHRVKKRP---PTWrhnvrakytEGDTATKGDLMHI 322 Rachiplusia ou MNPV
P28977 306 SAAQAFELEGLRASFAELDSRFRQLSEILDTVISSIAKIDERLIGRLIKAPVSSRFISEDKFLLHQCVDSVANNTNCVGD 385 Thogoto virus (isolat...
Q8B9D4 323 QEELMYENDLLKMNIELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTSNCYNN 402 Rachiplusia ou MNPV
P28977 386 SAYVDGRWTHVGDNHPCttvvdepigIDIYNFSAL--------WYPSAAEVDFRGTVQSEDGWSFVVKSKDALIQTMMYT 457 Thogoto virus (isolat...
Q8B9D4 403 SIYKEGRWVANTDSSQC---------IDFSNYKELaidddvefWIPTIGNTTYHDSWKDASGWSFIAQQKSNLITTMENT 473 Rachiplusia ou MNPV
P28977 458 KNGGKGTSLTDLLDYPSGWLKGQLGGLLYGNIGVYLLIAFAFVLLIRLIKSAGL 511 Thogoto virus (isolate SiAr 126)
Q8B9D4 474 KFGGVGTSLSDITSMAEGELAAKLTSFMFGHVVNFVIILIVILFLYCMIRNRNR 527 Rachiplusia ou MNPV
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap