Conserved Protein Domain Family
RGP

?
pfam03214: RGP 
Reversibly glycosylated polypeptide
Statistics
?
PSSM-Id: 367397
Aligned: 11 rows
Threshold Bit Score: 524.301
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006850293   6 MNQDEVDVVITALNPNLGPFLEEWRPVLTPYHLIIVKDPILdhkQQDLNIPPGFNSDVYTKSHMETLLGHDllSSLHFSG 85 
KRH00887       6 INENEVDIVIGALHSDLTTFMNEWKPIFSRFHLIIIKDPDL---KEELRIPEGFSVDVYTKSEIERVVGSS--TSVRFSG 80 
XP_006371261   6 IKDSEVDIVIGALHSDLTSFMNEWRPIFSRFHLIIVKDPDL---KEELRIPEGFNLDVYSKSHIDRVVGSS--SSIVFSG 80 
XP_002279911   6 IGDDEVDIVIGALHADLTSFLNEWRPLFSRFHLIIVKDPDL---REELKIPEGFNLHVYTKSDIDRVVGSSy-TAINFSG 81 
Q9FFD2         6 INKNEVDIVIGALNADLTQFLTSWRPFFSGFHLIVVKDPEL---KEELNIPEGFDVDVYSKTDMEKVVGAS--NSTMFSG 80  thale cress
Q7FAY6         5 IQDSEVDIVIAALQPNLTTFFEAWRPFFSRFHIIVVKDPDM---AEELQIPTGFDLKVYTKSDM-GVLGA---TSIDFSG 77  Japanese rice
EDQ60504       8 vlpGEVDVVVAALKPDLG-YLEVWREMLKGCHLIVVQGEAF---PEPIRVPEGFDADVYTRDDIVKLLSAElvKKLGFNG 83 
BAF46284       4 PLADQLDIVIPTIR-NLD-FLEEWRPFFQPYHLIIVQDGDP---TKKIAVPEGFSYELYNRNDIERILGDKa-WSISFKD 77 
EFH40332      13 PLKDDVDIVIPTIR-SLD-FLEQWRPFLQHYHLIIVQDGDP---SIKIKVPEGYDYELYNRNDINRILGPRa-NCISYKD 86 
XP_002511153  11 pLKDELDIVIPTIR-NLD-FLEMWRPFFQPYHLIIVQDGDP---NKTVRVPDGFDYELYNRNDVNRVLGPKs-NCISFKD 84 
XP_006340504   6 VRDDEVDIVIAAIEPDLTSFLEEWRAIFSRFHLIIIKDPDV---KGELKIPGGFNYDTYTKADIQQIIGPS--NAATFSG 80 
XP_006850293  86 LSARYFGYLVSTRRYIVAIDPDCVPMIDEKGHLVDPIKQHLQNLTSPSTPYYFNTLYDPYRPGTDFVRGYPFSLRSGAST 165
KRH00887      81 YSCRYFGFLISRKKYVVCIDDDCVPAKDNLGILVDAVAQHIVNLQTPATPFFFNTLYDPFCKGADFVRGYPFSLRSGVDC 160
XP_006371261  81 YSCRYFGFLVSRKKYIVSIDDDCIPAKDSKGFLIDAVAQHLANLTTPATPFFFNTLYDPYREGADFVRGYPFSLRSGVTC 160
XP_002279911  82 YSCRYFGYLMSRKKYIFSVDDDCIPAKDDKGLSVDAVDQHITNLATPATPFFFNTLYDPFRKGTDFVRGYPFSLRSGVTC 161
Q9FFD2        81 YSCRYFGYLVSKKKYIVSIDDDCVPAKDPKGFLVDAVTQHVINLENPATPLFFNTLYDPYCEGADFVRGYPFSLRSGVPC 160 thale cress
Q7FAY6        78 HSCRYFGYLVSRKKYVISIDDNCLPAKDNGGLTVDAVAQHMSNLKTPATPFFFNTLYDPFRKGADFVRGYPFSLREGVEC 157 Japanese rice
EDQ60504      84 RSCRSFGYLMAKRRYVFSMEPDCSPAQDPEGYVVNPVVEHVVNLKIPATPLFFNTLYDPYRVGTDFVRGYPFSWREGVPT 163
BAF46284      78 SACRCFGFMVSKKKYIYTIDDDCFVAKDPSGKPINVLEQHIKNLLSPSTPFFFNTLYDPYREGTDFVRGYPFSLREGVTT 157
EFH40332      87 GGCRCFGFMVSKKKYIYTIDDDCFVAKDPSGKEINVIAQHIKNLETPSTPHYFNTLYDPFREGTDFVRGYPFSLREGVQT 166
XP_002511153  85 SACRCFGFLVSKKKYIFTIDDDCFVAKDPSGKEINALAQHIQNLLTPSTPFFFNTLYDPYREGADFVRGYPFSMRGGVAT 164
XP_006340504  81 YSCRYFGYLLSKKKYIISIDDDCIPAKDTKGIQVDAIAQHINNLLTPATPFFFNTLYDPFCKGADFVRGYPFSLRSGVSC 160
XP_006850293 166 ALSCGLWVGLPDYDAPTALVKAGLTNSRCVNAVMTVPRGAFFPVSGVNLAFDKSLIGVAMFSGLLM--QGKTRYETLEDI 243
KRH00887     161 ALSCGLWLNLADLDAPTQALKPGQRNLRYVDAVVTVPSRAMVPVSGINIAFNREVVGPALVPALRLagEGKLRWETMEDI 240
XP_006371261 161 ALSCGLWLNLADLDAPTQALKAGQRNSRYVDAVMTIPSRAMMPISGINIAFDREAVGPALLPALKLagEGNLRWETMEDI 240
XP_002279911 162 ALSCGLWLNLADHDAPTQALKPGHRNSRYVDAVLTVPARALMPVSGVNIAFNRELAGPALFPGLRLaaEGKLRWETVEDI 241
Q9FFD2       161 AASCGLWLNLADLDAPTQALKTEKRNTAYVDAVMTVPAKAMLPISGINIAFNRELVGPALVPALRLagEGKVRWETLEDV 240 thale cress
Q7FAY6       158 MLSCGLWLHNADYDPMTHVVKRNQRNTTYVDAVMTVPLGAMMPVSGINVAFNREVLGPVMFPALRLrkEGKHRWDTLEDV 237 Japanese rice
EDQ60504     164 AVSLGSWKN--------------ATTGRYVDATLTIPRNTLYTMSGINLAFDRSLVGPLMFEPPQLasA-----NGAGEL 224
BAF46284     158 ATSHGLWMNIPDYDAPTQMVKPKERNTRFVDAVMTIPKGTLYPMCGMNLAFDRELIGAAMYFGLMGegQPIGRYD---DM 234
EFH40332     167 AISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKGVLYPMCGMNLAFNRELVGPAMYFGLMGegQPISRYD---DM 243
XP_002511153 165 AISHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAMYFGLMGdgQPIGRYD---DM 241
XP_006340504 161 ALSCGLWLNLADLDAPTQALKPELRNTRYVDAVLTVPARAMMPLSGINIAFDRELVGPALLPSFKLakEGKFRWETVEDV 240
XP_006850293 244 WAGLCAKAICDHLGYGAKSGLPYVVRRkgGGSEALEALKKEWKGVKWMEEVLPFFQSLTLPRTAVTAEDCILEIAKNVKV 323
KRH00887     241 WCGMCVKVICDHLGLGVKSGLPYVWRT--ERGDAIQSLKKEWEGVKLMEDVVPFFQSLRLPQSATTAEDCVVEMAKTVKE 318
XP_006371261 241 WSGMCVKVVCDHLGLGVKSGLPYVWRK--DRGSAIESLKKEWEGVKLTEEIVPFFQLVRLPQTAATTEDCILEMATTVKQ 318
XP_002279911 242 WCGLCVKVVCDHLGLGVKTGLPYVWRN--DRGNAIESLKKEWEGVKLMEEVVPFFQSVRLSQAAVTTEDCMLEIVALVKE 319
Q9FFD2       241 WCGMCLKHISDHLGYGVKTGLPYVWRN--ERGDAVESLRKKWEGMKLMEKSVPFFDSLKLPETALKVEDCVIELAKAVKE 318 thale cress
Q7FAY6       238 WNGLCAKVVCDRLRYGVKTGLPYVMRSdaEAGKALESL-KEWEGVKVMDVVLPFFESLKLSSTSVTVEDCVKELTSIVKE 316 Japanese rice
EDQ60504     225 WAGLCCKTICDHNYWGVKTGLPYICRNeaNVANEKAAL-GQGDGNKL-DLIAGFFQTIRLSGNPVDVKGCYLELAEQAKS 302
BAF46284     235 WAGWCTKVICDHLGVGCKTGLPYVWHS--KASNPFTNLRKEYKGIFWQEEIIPFFQNVTLSKTCTNAEECYIELADKVRK 312
EFH40332     244 WAGWAAKVVCDQLGFGVKTGLPYLWHS--KASNPFVNLKKEHKGLHWQEDMVPFFQNLCLSKESDTAAKCYMEISKMTKE 321
XP_002511153 242 WAGWCAKVICDHLDLGVKTGLPYIWHS--KASNPFVNLKKEYKGIYWQEDIIPFFQSVALPKECNTVQKCYIELSKLVKE 319
XP_006340504 241 WTGMCVKVVCDHLGYGLKTGLPYVWRK--ERGDAIESLKKEWEGVKLMEEVVPFFQSMKLTPAAKTAEDCVIEIAAAVKE 318
XP_006850293 324 GLGGVDAAFVHAAVAMEDWVRAWKSV 349
KRH00887     319 QLGKVDPMFSAAAEAMEEWVKLWKSV 344
XP_006371261 319 QLGPSNPVFTRAAEAMVEWVKLWKAV 344
XP_002279911 320 RLATLDPVFARAAQAMADWIKLWKAV 345
Q9FFD2       319 QLGSDDPAFTQAADAMVKWVQLWNSV 344 thale cress
Q7FAY6       317 KLGPQNAIFAKAADAMEEWTKLWKSH 342 Japanese rice
EDQ60504     303 RLSAGDPTFNEVASSMQAWIAAWSKL 328
BAF46284     313 GLGHIDPYFSKLADGMIAWIEGWRML 338
EFH40332     322 KLTKVDPYFEKLADAMVTWIEAWEEL 347
XP_002511153 320 KLGHIDPYFTKLGDAMVTWIEAWDEL 345
XP_006340504 319 QLGRIDPVFTRAADSMVEWVQLWKTV 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap