1T9H,2YV5,1U0L


Conserved Protein Domain Family
RsgA_GTPase

?
pfam03193: RsgA_GTPase 
Click on image for an interactive view with Cn3D
RsgA GTPase
RsgA (also known as EngC and YjeQ) represents a protein family whose members are broadly conserved in bacteria and are indispensable for growth. The GTPase domain of RsgA is very similar to several P-loop GTPases, but differs in having a circular permutation of the GTPase structure described by a G4-G1-G3 pattern.
Statistics
?
PSSM-Id: 397348
View PSSM: pfam03193
Aligned: 61 rows
Threshold Bit Score: 158.47
Threshold Setting Gi: 2496301
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T9H_A  72 IKERTNELIRPP--------------ICNVDQAVLVFSAVQPSFSTALLDRFLVLVEANDIQPIICITKMDLIEDQDted 137 Bacillus subtilis
Q7UUZ6  79 VEPRTGMISRTSrgrq-------hvlVSNIDAMLIIASAEQPGIKPALIDRMILTAHQCQIEPIVIINKVDLIDLVD--- 148 Rhodopirellula baltic...
Q8A5I9  63 IEDRKNYIIRRSsnlsk----qshilAANLDQCMLVVTVNYPETSTIFIDRFLASAEAYRVPVKLVFNKVDAYNEDElr- 137 Bacteroides thetaiota...
P59946  65 IHPRRNYIIRRAsnlsk----eshilGANLDAAVLVCTINDPVTTTVFIDRFLATAEAYRVPVILVFNKIDCYTQEDrl- 139 Porphyromonas gingiva...
Q8KC52  70 VEERRTALVRRRevrrnrskekeqviVANIDQLVLITSFDDPPFNSRLVDRYLVFAESEKLPLLIVVNKIDLDEEGM--- 146 Chlorobaculum tepidum...
Q8ETB7  86 VLPRFSSIVRKVaglrt----daqivASNVTKVFIVISAD-EDLNERKLERYLTAVWESGASPHIVFSKVDLASDMD--- 157 Oceanobacillus iheyen...
Q82LC4  96 YLPRRSAFVRSTsskrs----egqilAANVDYAVVAVSLA-VELDLGRVERFLALAWESGAQPVVVLTKADLVPDATtl- 169 Streptomyces avermiti...
Q8EZ61  87 ILPRKTFLRRSNpgkrk----gsqaiASNIDLLLVIMGLD-NDYSPRRIERYLFLAKVSGAQVTIVLNKKDLCMDPE--- 158 Leptospira interrogan...
O51126  67 RLSRKNILWRYNkkadl-----rqtiVSNIDNVLIVSSANFPEMKNFFIDRVLIVAEEQNIVPIIVINKIDKGISQK--- 138 Borreliella burgdorfe...
Q8NSB3  94 LEERTSVLRRTAddtdp----ferivVANADQLLIVSAVADPPPRAGFVERALIAAFVGNLQPVLCLTKSDLADPAE--- 166 Corynebacterium gluta...
1T9H_A 138 tIQAYAEDYRNIG-YDVYLTSSKDQDSLADIIPHFQD-KTTVFAGQSGVGKSSLLNAISP-ELGLRTNEISEHLGRGKHT 214 Bacillus subtilis
Q7UUZ6 149 -LQPLIGVYSSLG-YRVLPTSAETGQNVAYLRALLKD-RQTALAGQSGVGKSSLLNAVQP-GLGLAIGAVSSDNDKGKHT 224 Rhodopirellula baltic...
Q8A5I9 138 yLDALINLYTHIG-YPCFKVSAKEGTGVDAIKKDLEG-KITLFSGHSGVGKSTLINAILP-GTKVKTGEISTYHNKGMHT 214 Bacteroides thetaiota...
P59946 140 qLDRLSAVYTAIG-YPCCHVSAITGEGLPDLKSLLDG-KLTLLAGHSGVGKSSLINALIP-HADLRTGAISQAHHTGMHT 216 Porphyromonas gingiva...
Q8KC52 147 -VEEDLEVYRQLD-CNICLVSAEDGRGIEELRELLRD-RVSAFSGHSGVGKSTLINLLVG-CEELRTAETSGKTGKGVHT 222 Chlorobaculum tepidum...
Q8ETB7 158 -SIIEHADSIAFG-IPLYKWNATNEEGKEDILANIHEdDSVVLIGSSGAGKSTLINALLTeK-VLKTGSVREDDKRGRHT 234 Oceanobacillus iheyen...
Q82LC4 170 sYLVQDVETAAPG-VPVLSVSSNLGEGLDVLAAVLSG-GTSVLLGQSGAGKSTLANALLGeD-VMKVHATRDVDGKGRHT 246 Streptomyces avermiti...
Q8EZ61 159 --NKFMEIKTIAGeTPIEMISALDLKQTRTILQWIDPgKTITFLGSSGAGKSTIINSLLGgE-IQKTNEVKVSDGTGKHT 235 Leptospira interrogan...
O51126 139 -AQEFSEIYENLG-YKVLKTSVKTYEGIKEVKEVLKN-SRTSFIGQSGVGKSSLINLIDS-RASQSVNEISHKYSRGKHT 214 Borreliella burgdorfe...
Q8NSB3 167 ----FAAEFEALE-VPVVVCGVD--DPLDPVLEVVEG-HITALIGHSGVGKSTLVNRLVP-DADRETGVVSG-VGKGRHT 236 Corynebacterium gluta...
1T9H_A 215 TRHVELIHTS----GGLVADTPGFSSLEFT 240 Bacillus subtilis
Q7UUZ6 225 TTASQLIPLAd---GGAVFDTPGIRQFQLW 251 Rhodopirellula baltica SH 1
Q8A5I9 215 TTFSEMFSVDg---DGYIIDTPGIKGFGTF 241 Bacteroides thetaiotaomicron VPI-5482
P59946 217 TTFSQMIDFPdlspGSALIDTPGIKGFGTL 246 Porphyromonas gingivalis W83
Q8KC52 223 TTSSAMFQLPg---GGYVIDTPGIREFNLA 249 Chlorobaculum tepidum TLS
Q8ETB7 235 TTHRELFNLPt---GGVIIDTPGMRELQLW 261 Oceanobacillus iheyensis HTE831
Q82LC4 247 TTTRNLLALPg---GGVLIDTPGLRGVGLW 273 Streptomyces avermitilis MA-4680 = NBRC 14893
Q8EZ61 236 TTRRELFLLPs---GGVLMDNPGIREVGLF 262 Leptospira interrogans serovar Lai str. 56601
O51126 215 TVYSISFHSD----SGIIVDTPGIKEFGIE 240 Borreliella burgdorferi B31
Q8NSB3 237 STQSVALAID----NGWIIDTPGIRSFGLA 262 Corynebacterium glutamicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap