Conserved Protein Domain Family
Tektin

?
pfam03148: Tektin 
Tektin family
Tektins are cytoskeletal proteins. They have been demonstrated in such cellular sites as centrioles, basal bodies, and along ciliary and flagellar doublet microtubules. Tektins form unique protofilaments, organized as longitudinal polymers of tektin heterodimers with axial periodicity matching tubulin. Tektin polypeptides consist of several alpha-helical regions that are predicted to form coiled coils. Indeed, tektins share considerable structural similarities with intermediate filament proteins. Possible functional roles for tektins are: stabilisation of tubulin protofilaments; attachment of A and B-tubules in ciliary/flagellar microtubule doublets and C-tubules in centrioles; binding of axonemal components.
Statistics
?
PSSM-Id: 335240
View PSSM: pfam03148
Aligned: 151 rows
Threshold Bit Score: 172.718
Threshold Setting Gi: 156352206
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q26623        18 YSNHANYNSAEKQRASAERLIDESDRLIDETDEATKKTQRDVNKKFEQRLDDVTYWKDELDRKLKDSKDEIEMLLAYKTR 97  purple sea urchin
A8J8F6        38 LESVEQMGLGATENRMSSTLRDASSQLQAVASATVANDISIVDRALTTKLSQTESLKNMLETCLAEVISEIAELLSTKKR 117 Chlamydomonas r...
XP_009030133  20 egNYARFYQSFAGRNELGQLQTDINAIVKETKDKTSQMQAMNTKRLVDRVRDIDGWKRELHSIIKDMTEETELLFSQKNR 99  Helobdella robusta
XP_009019508  20 evmYARFRQILSDLNNAENVNKVSREIISKIERNARQIQFNSTRHLKDRVGDITLWKNQLCEEIKETALEIIQLNEFKTR 99  Helobdella robusta
GAA33438      54 elLEQRYAQSDQSLNLSQRIRSDCNDLLLETDALSKKNTHNLTLRLKERLHDTNFWKTELEREIDDMIRVTDKLLQRKRE 133 Clonorchis sine...
CUT99135      54 TALENRLALAQLDVDVGEKNRSDNRNMMMEAEEQSKADFQNTTERLRERLTDLHLWKTEMEKEILKVIDMSESLLRRLAE 133 Echinococcus mu...
CDS28440      54 RNLQNRLLLVEKDVEISQKFRENTVDLICSTLEKTKYNFTNTTESFRSRLQDIHHWARELENEIYRSVTITDFLIRRFGE 133 Hymenolepis mic...
XP_001697824  38 leSVEQMGLGATENRMSSTLRDASSQLQAVASATVANDISIVDRALTTKLSQTESLKNMLETCLAEVISEIAELLSTKKR 117 Chlamydomonas r...
XP_001622655  14 NASVRNIRLGQTVVNRSDKAC-DMGQQLDPLPSLRDTSIQQSNARIHAYVRATRAVLVKLQENLLDTNEEIKSLIKGKET 92  starlet sea ane...
XP_003972094  56 SNYHSILQQACDHRVRARSVQRESKTLKQDGEADTQQSQADGTRHLGARLQDIHLLKSELQRSIEQLMADTHALMALKKR 135 torafugu
Q26623        98 LENALEACREPLAIVNQCLNDREGRIGIDLVHDDVEKNLLKEREVIMGVMALLQKTLDQVIEQIRIMRSRRYNLEKDLTD 177 purple sea urchin
A8J8F6       118 LEERNGKVQAKIGVNSNRMQVRSSRPPREMTMDEVEKGLIKQQGMLGSFSDRVARAVAQVDREVAQLEAVRAKLEADLRD 197 Chlamydomonas r...
XP_009030133 100 VEAALRALEIPHHIALDNLNCRQKRQGIDLVQDDVELALLKEIETISGAEELLRRTTQEVEIQLKRNRDQKQNLEFDWSD 179 Helobdella robusta
XP_009019508 100 LEKAQLAHEIINMIVSDNLNAREHRDGVDKVQDNVELGLLKELEITNSAMELLKRTLKQCEEQIKRNKNCKHEMEMDWSD 179 Helobdella robusta
GAA33438     134 LENALMVVEQAIHVCTDNLNARRRHYGEDLQQDDVELQLIKELDILNKSAQLYKRAIEQCEYQIKRNRDSKQDLEMIWSD 213 Clonorchis sine...
CUT99135     134 LNTSLKALDECVLLTTDCLNARQRRFGEDLQQDEVELQLIKELDILNKAIALIKRSIEQVNDQLNRNRLAKTNLEKAWSD 213 Echinococcus mu...
CDS28440     134 LETSLKALDECLLLTTDCINARQRRFGEDLQQDTVEIQLLRELDMINKHIAFTKEAITSINEQVKKNREAKANMEKAWSD 213 Hymenolepis mic...
XP_001697824 118 LEERNGKVQAKIGVNSNRMQVRSSRPPREMTMDEVEKGLIKQQGMLGSFSDRVARAVAQVDREVAQLEAVRAKLEADLRD 197 Chlamydomonas r...
XP_001622655  93 LEKTLEHIRKDIVLNNKSTSIRKTRPPREKSPDGADDLLTAERKHLLKLKRILEAQLRSAQKQLQVLDANRKRLRAAVQE 172 starlet sea ane...
XP_003972094 136 LEKALDATQIPYAIATDNLNCRTRRPPADLVRDSVEDELLKEVDLIRSVQALLKRTTAQVASQIAMNREAKQTLELDWSD 215 torafugu
Q26623       178 KFGALDIDQDCRNLRDDNSTL------QF--KGGVAKIET--N--SVTPEDWQSFSNENILKAERDRKNSADLRAVVDSL 245 purple sea urchin
A8J8F6       198 KTEALRVDEAVLSIPTD-PTV------EGtlSPTFRRGAA--DcpPKTPHTWVRNTEDNLRNAHHWLADSARLRKAIAHA 268 Chlamydomonas r...
XP_009030133 180 KKESKELDEFCARLRSEHTSK------QY--YHGTARLQE--I--QSTPESWAQFTHDNIERAEQERLASIQLRKLIDSI 247 Helobdella robusta
XP_009019508 180 KKEAHDNDCFNASLKEDSRCK------QF--YPAAAKFQE--I--QSTPESWAQFTHDNLAKAEQERMSSIQLRCLIDNL 247 Helobdella robusta
GAA33438     214 KLEASQLLDQAAKLDVYSTNK------QF--YHGEARRHPlaA--QSTVESWAQHTHDAILRSEHERMASEELWTVTTNI 283 Clonorchis sine...
CUT99135     214 KHEADMLDTEGAHLTPESTNK------QH--YAGEARSWP--QaaQSTVKSWTQHAHDLILSSEHERIASDNLLQLCENI 283 Echinococcus mu...
CDS28440     214 KHEADLLDSEAAHLSITSGNT------QY--YPGEARAWP--QaaQSTPISWMQHAQDLILVSEEQRRASCYLSDLVEKL 283 Hymenolepis mic...
XP_001697824 198 KTEALRVDEAVLSI-PTDPTVegtlspTF--RRGAADCPP------KTPHTWVRNTEDNLRNAHHWLADSARLRKAIAHA 268 Chlamydomonas r...
XP_001622655 173 RSRVMDLICHAVSSVRGAGIK------DQieRPSTPEVEP--------LGPYTPECARVISEAADARQRSSTLRKEVAEA 238 starlet sea ane...
XP_003972094 216 KQQAYGLDERGGGYSNMSLDT------QH--HPGSASMQE--Q--LCNSASWAEFTQVNLSKAQHEHQTTQSLRALAEGI 283 torafugu
Q26623       246 LKTTADDMQQQVDDTNLAFSKRIRETDMTKGKLETHLAKVE-GQMREMEENIQKLQKGVDDKMGPKKLSETRLDARTNRP 324 purple sea urchin
A8J8F6       269 VANSRATEHDVANRLNENMLAKVAATRNLREDLQAQLEKVR-EEQARAKGQRSALTSALDDKRGPLAQARERLAVRKARP 347 Chlamydomonas r...
XP_009030133 248 IHDVSSDVKRQCGVTDDSFRRRVAQLEGCKNQLEDEINKVVcDSIDDAEKTISGLKGMLKDIEEPMKVAQTRLHNREFRP 327 Helobdella robusta
XP_009019508 248 LDTTANDIRKQADDVNFLFNNRIKVLSETLWKLNEDLTKVN-KMVYNCELNIETIKRSIKNYEELMKVAQTRLRNRENRP 326 Helobdella robusta
GAA33438     284 LHDVSNDIVQQKDTVNAALQNHLTKLENELFTYQQKLKETT-DEIREVEKTVENLRCAISDKDNYIKLVQTRLHLHNQRP 362 Clonorchis sine...
CUT99135     284 LHDVERDVIQQKDTVNAAFQRRLDEYECEKKNLTDKLRKTC-DEIAKMEQSIKELENAIVAKDAHVQTVQTRLHLHNQRQ 362 Echinococcus mu...
CDS28440     284 LISTEKTIIAQKDRVNVVLLKRLEEYEFEKQELINKLGRLS-KEILKVEESIEELKRAKAAKDAYVKVVQTRLHLHNQRK 362 Hymenolepis mic...
XP_001697824 269 VANSRATEHDVANRLNENMLAKVAATRNLREDLQAQLEKVR-EEQARAKGQRSALTSALDDKRGPLAQARERLAVRKARP 347 Chlamydomonas r...
XP_001622655 239 IEQTIKLQKAAHNSVNDGLTQKVAETVSMRQHLQVGGGELR-MSIHRSKRWYNATEMALGYTLGPVAYSDLTTREHLDRP 317 starlet sea ane...
XP_003972094 284 LQDTTEDLRVQCSRVDQAFSRRCEELVEAKTQLEVKLAQIL-EQIGDQETNIVSLEQAVHNKEAPLRVAQSRLYLRSLRP 362 torafugu
Q26623       325 NVELCRDPVQYRLIGEVTEINTSIARLQATLAQAQSELKGLIRNQLNLQEDIDIKSQSLNVDDTQCMTLRRSI 397 purple sea urchin
A8J8F6       348 CRENVNDEVEAALAKEVAHLAAVTQQLSVKVAAVDREIAALDATAAQLESNIADKDDALRVDE-RVVLLDGRI 419 Chlamydomonas reinhardtii
XP_009030133 328 RVELCRDPAQFGLIEEVKELSTSNDELYRKLEETENYLKLLQDQRIALEKDLMIKKNSIFIDKEKCMPRRATr 400 Helobdella robusta
XP_009019508 327 NVELTRDPAQYSLVSEVNELARSLDALIQKTNESESALKDMLDERTLLEKNKLVVEYSIFIDREKCLPHRTRY 399 Helobdella robusta
GAA33438     363 GVDNTRDKPQKAMLDELVDLEQILDRLNDQLIVAETNLKRLQDNQMMLEKQVQSKQHAIQVDRDHVVRHREVF 435 Clonorchis sinensis
CUT99135     363 NVENCRDPPQKAMLDEMHNVEETIDKLRNQLSNTENNLRHLQDEQMALEKQIHMKNASIQVDRDHCARHRMHF 435 Echinococcus multilocu...
CDS28440     363 NVESCRDPPQQLMLNELHDLNEIIDQLENQIQSSIEKLKHLQDEQLILERQIHMKNASIQVDRDHCVGHRERF 435 Hymenolepis microstoma
XP_001697824 348 CRENVNDEVEAALAKEVAHLAAVTQQLSVKVAAVDREIAALDATAAQLESNIADKDDALRVDErvvlldgrin 420 Chlamydomonas reinhardtii
XP_001622655 318 TVKIFQRHPGNQL-PEAREIGRGGQGLQESLNATARNIGLLKLTKDRIDSDASDKHHASLIDS-NVVRDRRRH 388 starlet sea anemone
XP_003972094 363 NMELCRDQAQLSLEAEVRQIEATVASLEQQLREARSSLSRLEESRVALEKDINCKTHSLFIERDKCTAQRRRY 435 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap