Conserved Protein Domain Family
Astro_capsid_N

?
pfam03115: Astro_capsid_N 
Astrovirus capsid protein precursor
This product is encoded by astrovirus ORF2, one of the three astrovirus ORFs (1a, 1b, 2). The 87kD precursor protein undergoes an intracellular cleavage to form a 79kD protein. Subsequently, extracellular trypsin cleavage yields the three proteins forming the infectious virion.
Statistics
?
Aligned: 2 rows
Threshold Bit Score: 629.538
Threshold Setting Gi: 81975248
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O12792  17 GRSRSKSRarsqsrgrdKSVKITVnsrNRARRQPGRDKRQSSQRVR-NIVNKQLR--KQGVTGPKPAICQRATATLGTVG 93  Human astrovirus 1
Q9JH68   6 GKAGPKAQ---------KKCKVVT---QKTKTVPKKTKQQKPRKVRlQKVERQVKtlKAKTRGPKISDTFSTVVTVGRII 73  Turkey astrovirus 1
O12792  94 SNTSGTTEIEACILLNPVLVKDATGSTQFGPVQALGAQYSMWKLKYLNVKLTSMVGASAVNGTVSGVSLNPTT-TPTSTS 172 Human astrovirus 1
Q9JH68  74 GNNDDSLTRQLKVFVNPLLMKNQDSGSTSSPLSIRASQYGLWKIAKLHVYFTPLAGSANVIGTVSFASLEQESgVATAES 153 Turkey astrovirus 1
O12792 173 WSGLGARKHLDVTVGKNATFKLKPSDLGGPRDGWWLTNTNDNASDTLGPSIEIHTLGRT---MSSYKNEQFTGGLFLVEL 249 Human astrovirus 1
Q9JH68 154 PDTIKAKYHAEVPIGSRFVWKVPPRMLTGPREGWWNMDSGDDPTNSVGPSISFWTYLKTilaLSTATTTSYLGSLFLIEI 233 Turkey astrovirus 1
O12792 250 ASEWCFTGYAANPNLVNLVK---STDNQVSVTfegsagsplimNVPEGShfartvLARSTTPTTL------------ARA 314 Human astrovirus 1
Q9JH68 234 RCTYLFSNYAPKPNLAIMVNekiTTTQPVTLT-----------NLSDGS------LVMTTTDTRLcalldndrgprgPNA 296 Turkey astrovirus 1
O12792 315 GERTTSDTVWQVlNTAVSAAELVTPPPFNWLVKGGWWFVKLIAGRTRTGSrSFYVYPSYQDALSNKpalctgstpggmRT 394 Human astrovirus 1
Q9JH68 297 QTNGPGEKFWAV-STLVVDTVAASIGPWGWLLKGGWWVIRKIFGAANTTS-TYAIYASVEDAAKDS------------RI 362 Turkey astrovirus 1
O12792 395 RNPVTTT-------LQFTQMNQPSLGH--GE 416 Human astrovirus 1
Q9JH68 363 YQPVSGTqtlaagdVYVTQLTQPNVNEagST 393 Turkey astrovirus 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap