3JBW


Conserved Protein Domain Family
RAG2

?
pfam03089: RAG2 
Click on image for an interactive view with Cn3D
Recombination activating protein 2
V-D-J recombination is the combinatorial process by which the huge range of immunoglobulin and T cell binding specificity is generated from a limited amount of genetic material. This process is synergistically activated by RAG1 and RAG2 in developing lymphocytes. Defects in RAG2 in humans are a cause of severe combined immunodeficiency B cell negative and Omenn syndrome.
Statistics
?
Aligned: 12 rows
Threshold Bit Score: 650.258
Threshold Setting Gi: 348505970
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JBW_B        54 KKGELKLRAISFSNNSSYLPPLRCPAIAHFEAQD---GKPECYLIHGGRTPNNELSSSLYMLSVDSRGcNRKVTLRCEEK 130 zebrafish
XP_005986966  51 KHRELKLRPVTFSNESCYLPPLRSSAVTSYLGSGe--SESLQYLIHGGRTPNNELSDKLYLMTLVSKAyNKKVILCCTEK 128 coelacanth
XP_006642507  51 KKGELKLRSVLFSNDSCYLPPLRCPAITHSGPEDlesSDTKKFLIHGGRTPNNELSGCLYIMSLDSRGcNKKVTLKCVEK 130 spotted gar
XP_003440533  51 KRGEMKLRAISFSNDSCYLPPLRCPAVCRLDPYD---GLPESYLIHGGRTPNNEISSSLYLLTMDSRGcNRKLTLRCKEK 127 Nile tilapia
O13034        51 KKGELKLRAISFSNNSSYLPPLRCPAIAHFEAQD---GKPECYLIHGGRTPNNELSSSLYMLSVDSRGcNRKVTLRCEEK 127 zebrafish
EOB07343      51 KQNELKMKPVFFSKDSCYLPPLRYPAICTFRGNEe--SDKHQYIIHGGKTPNNDLSDKIYIMSLVSKT-SKKTTFQCVEK 127 mallard
XP_001362290  51 KQNQLKLRPALFSKDSCYLPPLRYPAICTFQDSLe--LKKEQYIIHGGKTPNNELSDKIYIISAICKN-NKKVTFCCTEK 127 gray short-tail...
XP_001509136  51 KRNQLKLKPATFSKDSCYLPPLRYPATCTLKNSLe--PEKIQYIIHGGKTPNNELSNKIYVMAVACKS-NKKITFCCTEK 127 platypus
P34089        51 KQNHLKLKPAVFSKDSCYLPPLRYPATCTFQGSSe--SEKQQYIIHGGKTPNNELSDKIYVMSVVCKN-NKKVTFRCTER 127 rabbit
XP_017948752  51 KNNELRLRPTIFTNDSCYLPPLRHPAVCSLPASQg--GEITQYLIHGGKTPNNEISHKLYIMAMASSV-NRRFSLCCSEK 127 tropical clawed...
XP_003214696  58 KKDELKLKPAYFSKDSCYLPPLRYPAICILKSSAa-qPEKCQYIIHGGKTPNNELSDKLYIISLVSKN-NKKVTFRCTEK 135 green anole
XP_007228210  51 KRDELKLRAISFSNTSCYLPPLRYPAIARLKPHD---GSPESYLIHGGRTPNNELSSSLYMLSVDSRGcNRKVTLRCLEK 127 Mexican tetra
3JBW_B       131 ELVGDVPSARYGHTLSVINSRGKTACVLFGGRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFH 210 zebrafish
XP_005986966 129 ELEGDVPQARYGHTINMVYSRGKSMCVMFGGRSYMSPGQRTTENWNSIEDCMPQVYLIDLEFGCCTSYNFPELQDGMSFH 208 coelacanth
XP_006642507 131 ELAGDIPEARYGHTMSIVYSRGKRACLLFGGRSYMPPGQRTTENWNSVVDCLPKVFLIDLDFGCCSSYTFPELTDGQSFH 210 spotted gar
XP_003440533 128 ELVAEVPGPRYGHTMSMVQSRGKTACVLFGGRSYMPSGERTTESWNSVVDCPPQVFLFDLEFGCCSAHTLPELSDGQSFH 207 Nile tilapia
O13034       128 ELVGDVPSARYGHTLSVINSRGKTACVLFGGRSYMPPTERTTQNWNSVGDCPPQVYLIDLEFGCCTAHTLPELTDGQSFH 207 zebrafish
EOB07343     128 DLGGDVPEARYGHTINVVHSRGKSMSVIFGGRSYIPLAQRTTEKWNSVVDCLPSVFLVDFEFGCCTSYILPELQDGLSFH 207 mallard
XP_001362290 128 ELVGDIPEARYGHTIDVVYSRGKSRCVVFGGRSYMPSAQRTTEKWNSVVDCPPHVFLIDLEFGCCTSYNFPELQDGLSFH 207 gray short-tail...
XP_001509136 128 ELVGDIPEARYGHTIDVVYSRGKSMTVIFGGRSYMPPAQRTTEKWNSVIDCMPHVYLVDFEFGCSTSYVFPELQDGLSFH 207 platypus
P34089       128 DLVGDVPEARYGHSLDVVYSRGKSMGVLFGGRSYMPSNQRTTEKWNSVADCLPHVFLVDFEFGCATSYILPELQDGLSFH 207 rabbit
XP_017948752 128 DLEGDVPEARYGHSMNVVFSKGKTAVVMFGGRSYVPLNQRTTENWNNVIDCEPLVYLIDLQFGCSTSFNLRELQDGISFH 207 tropical clawed...
XP_003214696 136 ELIGEVPEARYGHTISEVHSQGKNMMVIIGGRSYMSLGQRTTESWNSVVDCMPDIFLIDLEFGCCTSYTLPDLQSGFSFH 215 green anole
XP_007228210 128 ELVGEPPGPRYGHTISVVHSRGKTACVLFGGRSYMPPTERTTENWNCVVDCPPQVYLIDLEFGCCSAHTLPELTDGQSFH 207 Mexican tetra
3JBW_B       211 VALARQDCVYFLGGHILSSDCRPSRLIRLHVELLLGSPVLTCTILHEGLTITSAIASPIG-YHEYIIFGGYQSETQKRME 289 zebrafish
XP_005986966 209 VSIARNDTVYLLGGHTLESKSRPPRLYRLKVDLLLGSPVVGCSELPGGISVSSAIVAQTG-ANEYVILGGYESETQKRMT 287 coelacanth
XP_006642507 211 VSLSRKDSVYVLGGHTLANNTRPARLFRFRVELLLGSPIVSCEVLNTGISVSSAIVTRVGsSHEYIIMGGYKSESEKRLE 290 spotted gar
XP_003440533 208 LALAREDCVYFIGGHSLASDSRPPRLFRLHVELLQGSPLLSCETLDNGLSISSAIFTRTGpTHRYIILGGYQSDSQKRME 287 Nile tilapia
O13034       208 VALARQDCVYFLGGHILSSDCRPSRLIRLHVELLLGSPVLTCTILHEGLTITSAIASPIG-YHEYIIFGGYQSETQKRME 286 zebrafish
EOB07343     208 VSVARNDTIYILGGHSLQNNTRSPSLYKLKVDLPLGSPALTCSVLPGGISVSSAIVTQTS-DTEFVLVGGYQSDSQKRLV 286 mallard
XP_001362290 208 VSIARDDTIYMIGGHSLSNNSRPPNLYRLKVDLPLGSPEVSCTVLPGGISISSAILTQTK-SNEFVIVGGYQFENQKRLV 286 gray short-tail...
XP_001509136 208 VSVARNDTVYILGGHSLTNNSRPPNLFRLKVDLPLGSPAVSCTVLSGGLSVSSAIVTQRN-SSEFVIVGGYQLDNLKRMA 286 platypus
P34089       208 VSIARNDTVYILGGHSLANNIRPANLYRIRVDLPLGSPAINCTVLPGGISVSSAILTQTN-NDEFVIVGGYQLENQKRMV 286 rabbit
XP_017948752 208 VSLARNDTVYIFGGHSMGNNFRPPNVYKIKVDLPLGSPAVSCTVIHNKLSFSSSIVTQTS-PDEFVIVGGYESDSQKRFS 286 tropical clawed...
XP_003214696 216 LCLTRNDTLYIIGGHSIQNNTRPPNLYRIKIDLPLGSPAVSCCALPGGISVSSAIVTQTN-NNEFVVIGGYHSDNQKRMV 294 green anole
XP_007228210 208 LALAREDCVYFLGGHILSTDCRPPRLFRLRVELLLGSPLLSCEVFNEGLSITSAIATSVGsAHEYIILGGYQSESEKRMQ 287 Mexican tetra
3JBW_B       290 CTYVGLDDVGVHMESREPPQWTSEISHSRTWFGGSLGKGTALVAIPSEGNPTPPE-AYHFYQVSFqk---eQDGEATAQG 365 zebrafish
XP_005986966 288 CNTAVLDDNSIQVLERESPDWPGDIKLSKTWFGSSMGGGAVFLGIPGENKQITNE-SNYFYRVNL------IEDEEITQT 360 coelacanth
XP_006642507 291 CNTVLLEDSGIHITSREPPEWSGEICHSKTWFGGNMGEGLVLIGVPADGRHNVPE-VHYFYTVNF------RQEEEPGQN 363 spotted gar
XP_003440533 288 CTTVILDEKGIHFEPVETPKWTPDIIHSRTWFGGSSGEGSILLAVPTEGRPSQQD-MHYFYQVNFqte-geTREEDGTLG 365 Nile tilapia
O13034       287 CTYVGLDDVGVHMESREPPQWTSEISHSRTWFGGSLGKGTALVAIPSEGNPTPPE-AYHFYQVSFqk---eQDGEATAQG 362 zebrafish
EOB07343     287 CNTIVLEDDKIEIVERASPDWTPDIKHCRMWFGCDMGKGSVLLGIPGANKQLISD-ANYFYILRCkgaeedEEEELTAQI 365 mallard
XP_001362290 287 CNIITVEDNKIEIQDMETPDWTPDIKHSKLWFGSSTGNGTVFLGIPGDNRQTLSD-AHYFYLLKCgge-dlMAEEQAAFS 364 gray short-tail...
XP_001509136 287 CHIIKLEDNKFEIEEMETPDWTPDIKHSKIWFGSNMGNGAIFLGIPGDNKQAISD-ANYFYILKCgqd-tkEEDDQATYT 364 platypus
P34089       287 CNIVSLEDNKIEIQEMETPDWTPDIKHSKIWFGSNMGNGSVFLGIPGDNKQIVSE-AFYFYMLKCte--ddVHEDQRTFT 363 rabbit
XP_017948752 287 CNGIFLDDDTIDIQEIETPEWTGEIKHSKTWFGADMGKGAVLFGIPVDNKHQSTDcSFFFYVLNFg------DSDPVVQT 360 tropical clawed...
XP_003214696 295 CNTINLEDNKIEIMEREAPEWTPEIKHCKIWFGSDMGNGAILFGIPGDNRQLTSD-SNYFYILKChge-ddQEAEQMVQV 372 green anole
XP_007228210 288 CTYVALDDVGIRMEPRDPPPWGSEISQSRTWFGGSLEKGNALIIIPSEGNPAPPD-ANYCYQVSFrh---eEDAEDPTQT 363 Mexican tetra
3JBW_B       366 GSQEST--DFEDSAPLEDSEELYFG 388 zebrafish
XP_005986966 361 CSQESTe-DQDDSTTFEDSEEFYIG 384 coelacanth
XP_006642507 364 CSQESTdqELEDSAPLEDSEEFYFN 388 spotted gar
XP_003440533 366 CSQEST--DYDDSTPLEDSEELYFG 388 Nile tilapia
O13034       363 CSQEST--DFEDSAPLEDSEELYFG 385 zebrafish
EOB07343     366 CSQASTe-DQGDSTPFEDSEEFCFS 389 mallard
XP_001362290 365 CSQASTe-DPGDSTPFEDSEEFCFS 388 gray short-tailed opossum
XP_001509136 365 CSQTSTe-DPGDSTPFEDSEEFCFS 388 platypus
P34089       364 NSQTSTe-DPGDSTPFEDSEEFCFS 387 rabbit
XP_017948752 361 CSQGSTe-EQEDSMPLEDSEEFTFN 384 tropical clawed frog
XP_003214696 373 CSQSSTe-DAGESTPFEDSEELTFS 396 green anole
XP_007228210 364 CSQEST--DFEDSAPLEDSEELYFG 386 Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap