3JBW


Conserved Protein Domain Family
RAG2

?
pfam03089: RAG2 
Click on image for an interactive view with Cn3D
Recombination activating protein 2
V-D-J recombination is the combinatorial process by which the huge range of immunoglobulin and T cell binding specificity is generated from a limited amount of genetic material. This process is synergistically activated by RAG1 and RAG2 in developing lymphocytes. Defects in RAG2 in humans are a cause of severe combined immunodeficiency B cell negative and Omenn syndrome.
Statistics
?
PSSM-Id: 308614
View PSSM: pfam03089
Aligned: 11 rows
Threshold Bit Score: 651.413
Threshold Setting Gi: 348505970
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JBW_B        54 KKGELKLRAISFSNNSSYLPPLRCPAIAHFEAQD---GKPECYLIHGGRTPNNELSSSLYMLSVDSRGcNRKVTLRCEEK 130
gi 464543     51 KQNHLKLKPAVFSKDSCYLPPLRYPATCTFQGSSe--SEKQQYIIHGGKTPNNELSDKIYVMSVVCKN-NKKVTFRCTER 127
gi 126332589  51 KQNQLKLRPALFSKDSCYLPPLRYPAICTFQDSLe--LKKEQYIIHGGKTPNNELSDKIYIISAICKN-NKKVTFCCTEK 127
gi 149409562  51 KRNQLKLKPATFSKDSCYLPPLRYPATCTLKNSLe--PEKIQYIIHGGKTPNNELSNKIYVMAVACKS-NKKITFCCTEK 127
gi 637245428  58 KKDELKLKPAYFSKDSCYLPPLRYPAICILKSSAa-qPEKCQYIIHGGKTPNNELSDKLYIISLVSKN-NKKVTFRCTEK 135
gi 514710559  68 KQNELKMKPVFFSKDSCYLPPLRYPAICTFRGNEe--SDKHQYIIHGGKTPNNDLSDKIYIMSLVSKT-SKKTTFQCVEK 144
gi 556948132  51 KHRELKLRPVTFSNESCYLPPLRSSAVTSYLGSGe--SESLQYLIHGGRTPNNELSDKLYLMTLVSKAyNKKVILCCTEK 128
gi 512833162  51 KNNELRLRPTIFTNDSCYLPPLRHPAVCSLPASQg--GEITQYLIHGGKTPNNEISHKLYIMAMASSV-NRRFSLCCSEK 127
gi 573909578  51 KKGELKLRSVLFSNDSCYLPPLRCPAITHSGPEDlesSDTKKFLIHGGRTPNNELSGCLYIMSLDSRGcNKKVTLKCVEK 130
gi 597731692  51 KRDELKLRAISFSNTSCYLPPLRYPAIARLKPHD---GSPESYLIHGGRTPNNELSSSLYMLSVDSRGcNRKVTLRCLEK 127
gi 348505970  51 KRGEMKLRAISFSNDSCYLPPLRCPAVCRLDPYD---GLPESYLIHGGRTPNNEISSSLYLLTMDSRGcNRKLTLRCKEK 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JBW_B       131 ELVGDVPSARYGHTLSVINSRGKTACVLFGGRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFH 210
gi 464543    128 DLVGDVPEARYGHSLDVVYSRGKSMGVLFGGRSYMPSNQRTTEKWNSVADCLPHVFLVDFEFGCATSYILPELQDGLSFH 207
gi 126332589 128 ELVGDIPEARYGHTIDVVYSRGKSRCVVFGGRSYMPSAQRTTEKWNSVVDCPPHVFLIDLEFGCCTSYNFPELQDGLSFH 207
gi 149409562 128 ELVGDIPEARYGHTIDVVYSRGKSMTVIFGGRSYMPPAQRTTEKWNSVIDCMPHVYLVDFEFGCSTSYVFPELQDGLSFH 207
gi 637245428 136 ELIGEVPEARYGHTISEVHSQGKNMMVIIGGRSYMSLGQRTTESWNSVVDCMPDIFLIDLEFGCCTSYTLPDLQSGFSFH 215
gi 514710559 145 DLGGDVPEARYGHTINVVHSRGKSMSVIFGGRSYIPLAQRTTEKWNSVVDCLPSVFLVDFEFGCCTSYILPELQDGLSFH 224
gi 556948132 129 ELEGDVPQARYGHTINMVYSRGKSMCVMFGGRSYMSPGQRTTENWNSIEDCMPQVYLIDLEFGCCTSYNFPELQDGMSFH 208
gi 512833162 128 DLEGDVPEARYGHSMNVVFSKGKTAVVMFGGRSYVPLNQRTTENWNNVIDCEPLVYLIDLQFGCSTSFNLRELQDGISFH 207
gi 573909578 131 ELAGDIPEARYGHTMSIVYSRGKRACLLFGGRSYMPPGQRTTENWNSVVDCLPKVFLIDLDFGCCSSYTFPELTDGQSFH 210
gi 597731692 128 ELVGEPPGPRYGHTISVVHSRGKTACVLFGGRSYMPPTERTTENWNCVVDCPPQVYLIDLEFGCCSAHTLPELTDGQSFH 207
gi 348505970 128 ELVAEVPGPRYGHTMSMVQSRGKTACVLFGGRSYMPSGERTTESWNSVVDCPPQVFLFDLEFGCCSAHTLPELSDGQSFH 207
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JBW_B       211 VALARQDCVYFLGGHILSSDCRPSRLIRLHVELLLGSPVLTCTILHEGLTITSAIASPIG-YHEYIIFGGYQSETQKRME 289
gi 464543    208 VSIARNDTVYILGGHSLANNIRPANLYRIRVDLPLGSPAINCTVLPGGISVSSAILTQTN-NDEFVIVGGYQLENQKRMV 286
gi 126332589 208 VSIARDDTIYMIGGHSLSNNSRPPNLYRLKVDLPLGSPEVSCTVLPGGISISSAILTQTK-SNEFVIVGGYQFENQKRLV 286
gi 149409562 208 VSVARNDTVYILGGHSLTNNSRPPNLFRLKVDLPLGSPAVSCTVLSGGLSVSSAIVTQRN-SSEFVIVGGYQLDNLKRMA 286
gi 637245428 216 LCLTRNDTLYIIGGHSIQNNTRPPNLYRIKIDLPLGSPAVSCCALPGGISVSSAIVTQTN-NNEFVVIGGYHSDNQKRMV 294
gi 514710559 225 VSVARNDTIYILGGHSLQNNTRSPSLYKLKVDLPLGSPALTCSVLPGGISVSSAIVTQTS-DTEFVLVGGYQSDSQKRLV 303
gi 556948132 209 VSIARNDTVYLLGGHTLESKSRPPRLYRLKVDLLLGSPVVGCSELPGGISVSSAIVAQTG-ANEYVILGGYESETQKRMT 287
gi 512833162 208 VSLARNDTVYIFGGHSMGNNFRPPNVYKIKVDLPLGSPAVSCTVIHNKLSFSSSIVTQTS-PDEFVIVGGYESDSQKRFS 286
gi 573909578 211 VSLSRKDSVYVLGGHTLANNTRPARLFRFRVELLLGSPIVSCEVLNTGISVSSAIVTRVGsSHEYIIMGGYKSESEKRLE 290
gi 597731692 208 LALAREDCVYFLGGHILSTDCRPPRLFRLRVELLLGSPLLSCEVFNEGLSITSAIATSVGsAHEYIILGGYQSESEKRMQ 287
gi 348505970 208 LALAREDCVYFIGGHSLASDSRPPRLFRLHVELLQGSPLLSCETLDNGLSISSAIFTRTGpTHRYIILGGYQSDSQKRME 287
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JBW_B       290 CTYVGLDDVGVHMESREPPQWTSEISHSRTWFGGSLGKGTALVAIPSEGNPTPPE-AYHFYQVSF--Q--K--EQDGEAT 362
gi 464543    287 CNIVSLEDNKIEIQEMETPDWTPDIKHSKIWFGSNMGNGSVFLGIPGDNKQIVSE-AFYFYMLKCt-E--D--DVHEDQR 360
gi 126332589 287 CNIITVEDNKIEIQDMETPDWTPDIKHSKLWFGSSTGNGTVFLGIPGDNRQTLSD-AHYFYLLKCg-G--Ed-LMAEEQA 361
gi 149409562 287 CHIIKLEDNKFEIEEMETPDWTPDIKHSKIWFGSNMGNGAIFLGIPGDNKQAISD-ANYFYILKC--G--QdtKEEDDQA 361
gi 637245428 295 CNTINLEDNKIEIMEREAPEWTPEIKHCKIWFGSDMGNGAILFGIPGDNRQLTSD-SNYFYILKC--Hg-Ed-DQEAEQM 369
gi 514710559 304 CNTIVLEDDKIEIVERASPDWTPDIKHCRMWFGCDMGKGSVLLGIPGANKQLISD-ANYFYILRC--KgaEe-DEEEELT 379
gi 556948132 288 CNTAVLDDNSIQVLERESPDWPGDIKLSKTWFGSSMGGGAVFLGIPGENKQITNE-SNYFYRVNL---------IEDEEI 357
gi 512833162 287 CNGIFLDDDTIDIQEIETPEWTGEIKHSKTWFGADMGKGAVLFGIPVDNKHQSTDcSFFFYVLNF--G-------DSDPV 357
gi 573909578 291 CNTVLLEDSGIHITSREPPEWSGEICHSKTWFGGNMGEGLVLIGVPADGRHNVPE-VHYFYTVNF---------RQEEEP 360
gi 597731692 288 CTYVALDDVGIRMEPRDPPPWGSEISQSRTWFGGSLEKGNALIIIPSEGNPAPPD-AHYCYQVSF--R--H--EEDAEDP 360
gi 348505970 288 CTTVILDEKGIHFEPVETPKWTPDIIHSRTWFGGSSGEGSILLAVPTEGRPSQQD-MHYFYQVNFqtE--G--ETREEDG 362
                        330       340
                 ....*....|....*....|....*....
3JBW_B       363 AQGGSQEST--DFEDSAPLEDSEELYFGR 389
gi 464543    361 TFTNSQTSTe-DPGDSTPFEDSEEFCFSA 388
gi 126332589 362 AFSCSQASTe-DPGDSTPFEDSEEFCFSA 389
gi 149409562 362 TYTCSQTSTe-DPGDSTPFEDSEEFCFST 389
gi 637245428 370 VQVCSQSSTe-DAGESTPFEDSEELTFSF 397
gi 514710559 380 AQICSQASTe-DQGDSTPFEDSEEFCFSA 407
gi 556948132 358 TQTCSQESTe-DQDDSTTFEDSEEFYIGc 385
gi 512833162 358 VQTCSQGSTe-EQEDSMPLEDSEEFTFNR 385
gi 573909578 361 GQNCSQESTdqELEDSAPLEDSEEFYFNR 389
gi 597731692 361 TQTCSQEST--DFEDSAPLEDSEELYFGR 387
gi 348505970 363 TLGCSQEST--DYDDSTPLEDSEELYFGR 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap