Conserved Protein Domain Family
NMO

?
pfam03060: NMO 
Nitronate monooxygenase
Nitronate monooxygenase (NMO), formerly referred to as 2-nitropropane dioxygenase (NPD) (EC:1.13.11.32), is an FMN-dependent enzyme that uses molecular oxygen to oxidize (anionic) alkyl nitronates and, in the case of the enzyme from Neurospora crassa, (neutral) nitroalkanes to the corresponding carbonyl compounds and nitrite. Previously classified as 2-nitropropane dioxygenase, but it is now recognized that this was the result of the slow ionization of nitroalkanes to their nitronate (anionic) forms. The enzymes from the fungus Neurospora crassa and the yeast Williopsis saturnus var. mrakii (formerly classified as Hansenula mrakii) contain non-covalently bound FMN as the cofactor. Active towards linear alkyl nitronates of lengths between 2 and 6 carbon atoms and, with lower activity, towards propyl-2-nitronate. The enzyme from N. crassa can also utilize neutral nitroalkanes, but with lower activity. One atom of oxygen is incorporated into the carbonyl group of the aldehyde product. The reaction appears to involve the formation of an enzyme-bound nitronate radical and an a-peroxynitroethane species, which then decomposes, either in the active site of the enzyme or after release, to acetaldehyde and nitrite.
Statistics
?
Aligned: 6 rows
Threshold Bit Score: 304.051
Threshold Setting Gi: 81817538
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O25465                    6 KPLKIGKHTIKFPIFQGGMGVgISWDELAGNVAKEGALGVIS---AVGTG----------YYKNMRFVERIVAKkPFEAL 72  Heli...
P71847                    4 RTPLTELIGIEHPVVQTGMGW-VAGARLVSATANAGGLGILAs--ATMTLd--------eLAAAITKVKAVTDK-PFGVN 71  Myco...
GLBRC_NREL:ZMO1_ZMO1861   5 nSRLSAILKIQYPLIQAPMSW-ITNADFVAAVSEAGGLGVLGphaGYHTPpkdpqeildrVRLEIRKVKSLTDK-PFGLN 82  Zymo...
O05413                    2 NEFMKKFSLTKPIIQAPMAGG-ITKPRLASAVSNQGALGSLAs--GYLTPd--------lLEQQIKEIFELTDA-PFQIN 69  Baci...
Q9RDD8                    2 SSALTDLFP-YPIVQAPMAGG-VSVPRLAAAVSEAGGLGFLAa--GYKTAd--------gMYQEIKQLRGLTSR-PFGVN 68  Stre...
CMQ27254                461 vlgfWDIA--VPIVGAPMAGG-PSTPALAAAVSNAGGLGFVAg--GYLSAd--------rLADDIAAARAATTG-PIGAN 526 Myco...
O25465                   73 NFYSKKALNEIfanark--icgnnpLGANILYAINdygrvlrd------sceaganIIITGAGLPtNMPEFAKDFSDVAL 144 Heli...
P71847                   72 IRADAADAGDR--------------VELMIREGVR---------------------VASFALAPK-QQLIARLKEAGAVV 115 Myco...
GLBRC_NREL:ZMO1_ZMO1861  83 LLLLKDDPLDDftk---------awLNIAFEEGVTh--------------------FVSVGNADNrVFNLIKEHDGIIIH 133 Zymo...
O05413                   70 VFVPLGLEMPPkdqikkwkeniplaNQVNQFTSVQeewddfyqki--dlilkykvkACSFTFDLPpEDAVKELKTAGCCL 147 Baci...
Q9RDD8                   69 LFLPQPETADPaavdvyahqlageaAWYETELGDPdcgrddgydtkvavlldnpvpVVSFHFGVPsREVVDSLHRVGTFA 148 Stre...
CMQ27254                527 LFVPQPSVADWaqleyyadeleevaEYYHTEVGQPvygddddwvrklevvadvrpeVVSFTFGAPpPDVVQRLSALGLLV 606 Myco...
O25465                  145 IPIISSAKALKILCKRWsdrykriPDAFIVEGPLSGGHQGf-----KYEdcfkeEFRLENLVPKVVEaskewgnIPIIAA 219 Heli...
P71847                  116 IPSIGAAKHARKVAAWG-------ADAMIVQGGEGGGHTG------PVA-----TTLLLPSVLDAVAgt----gIPVIAA 173 Myco...
GLBRC_NREL:ZMO1_ZMO1861 134 RPLTASITNMREAESLG-------ADVLVATGYDEGGMIPt----rAIg-----TFTVVPTMVDAVD-------IPVMAT 190 Zymo...
O05413                  148 IGTASTVEEALLMEERG-------MDIVVLQGSEAGGHRGaf--lpSKGesavgLMALIPQAADALS-------VPVIAA 211 Baci...
Q9RDD8                  149 LVGATTADEARAVEQSG-------ADAVIAQGMEAGGHQGthrdnpETGgagtgLLSLVAQVREAVS-------LPILAA 214 Stre...
CMQ27254                607 SITVTSVYEAGVAIAAG-------ADSLVVQGPAAGGHRGtfapdmEPGte--sLHQLLDRIGSAHD-------VPLVAA 670 Myco...
O25465                  220 GGIWDRKDIDTMLSLGASGVQMATRFLGTKECDAKVYADLLPTLKKEDILLIKSPVG-YPARAINTGVIKRIEEgnaPKI 298 Heli...
P71847                  174 GGFFDGRGLAAALCYGAAGVAMGTRFLLTSDSTVPDAVKRRYLQAGLDGTVVTTRVDgMPHRVLRTELVEKLESgsrARG 253 Myco...
GLBRC_NREL:ZMO1_ZMO1861 191 GGINDRRGVKAAFALGAEGVYIGTRFIVTKENPASEITKKKIVESGCDDIEFVSPKQ-RSIRTQAADILGSLYL---NKE 266 Zymo...
O05413                  212 GGMIDHRGVKAALTLGAQGVQIGSAFLICHESNAHPVHKQKILEANEADTKLTTLFSgKEARGIVNKWMEENEQ---FET 288 Baci...
Q9RDD8                  215 GGIMRGGQIAAVLAAGASAAQLGTAFLATSESGAHDLHKQALTNPLFVRTELTRAFSgRPARALVNRFLREHG-----PY 289 Stre...
CMQ27254                671 GGLGTAEDVAAVLRRGAIAAQVGTALLLADEAGTNAAHRAALKNPEFDATLVTRAFSgRYARGLANNFTRLLD-----HV 745 Myco...
O25465                  299 ACVSNCVAPcn---------------------------rgEEAKKvgycIADGLGRSylgNREEGLYFTGANGYRVDKII 351 Heli...
P71847                  254 FAAALRNAGkfrrmsqmtwrsmirdgltmrhgkeltwsqvLMAANtpmlLKAGLVDG---NTEAGVLASGQVAGILDDLP 330 Myco...
GLBRC_NREL:ZMO1_ZMO1861 267 NTLDLDTEI-------------------------------SRLGG----VRPAMLEG---KLDEGIISVNTGIDVIRSIP 308 Zymo...
O05413                  289 QTLPYPYQN-------------------------------TLTKA----MRQKASLQn--NHDQMSLWAGQGIRSLTEEI 331 Baci...
Q9RDD8                  290 APAAYPEVH-------------------------------HLTAP----VRKAAAKAg--DAQGMALWAGQGH-RMAREL 331 Stre...
CMQ27254                746 APLGYPEVH-------------------------------QMTKP----IRAAAVQAd--DPHGTNLWAGSAH-RKTRPG 787 Myco...
O25465                  352 SVHELIKELTEG 363 Helicobacter pylori
P71847                  331 SCKELIESIVLD 342 Mycobacterium tuberculosis
GLBRC_NREL:ZMO1_ZMO1861 309 TVKELVIDLLgl 320 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
O05413                  332 SVKQLLNQLCQE 343 Bacillus subtilis subsp. subtilis str. 168
Q9RDD8                  332 PAGQLVEVLVAE 343 Streptomyces coelicolor
CMQ27254                788 PAADIIASLTPd 799 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap