2CB5,2DZZ


Conserved Protein Domain Family
Peptidase_C1_2

?
pfam03051: Peptidase_C1_2 
Click on image for an interactive view with Cn3D
Peptidase C1-like family
This family is closely related to the Peptidase_C1 family pfam00112, containing several prokaryotic and eukaryotic aminopeptidases and bleomycin hydrolases.
Statistics
?
PSSM-Id: 281100
View PSSM: pfam03051
Aligned: 13 rows
Threshold Bit Score: 661.731
Threshold Setting Gi: 157834830
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2CB5_A   4 GLNSEKVAALIQKLNSDPQFVLAQNVGTTHDLLDICLKR-ATVQRAQHVFQHAVPQEgkPITNQKSSGRSWIFSCLNVMR 82  human
Q1G8V8   4 EISFDTIEDFTSNLSKHPAYGVAANAAQTNGIFKASQST-QSKVDLDPTFSVEIDTG--SVTNQKQSGRCWMFSALNTMR 80  Lactobacillus delbrue...
Q5FM39   4 EISKDTINKFEQDLTNHPAYKVASRAAQENGIFKASQDL-QTKIDLDPTFSIEIETG--KPADQKQSGRCWMFSALNTMR 80  Lactobacillus acidoph...
Q5M650   3 sLSTDFTEKLFADYKANAKYGAIENAVTHNGLLKSIETR-QSEVENDFVFSIDLTKD--EVSNQKASGRCWMFAALNTFR 79  Streptococcus thermop...
Q9CEG3   2 tVTSDFTQKLYENFAENTKLRAVENAVTKNGLLSSLEVR-GSHAANLPEFSIDLTKD--PVTNQKQSGRCWMFAALNTFR 78  Lactococcus lactis su...
O69192   4 ELTFEQLENFSRKWRENPDKLVFQASIMKNGIKAATENP-TSKVSIQPVFSHEVATD--KVSNQQQSGRCWMFAALNTFR 80  Listeria monocytogene...
Q1GBV7   4 ELSPQLLESFSRDFNADPKNQVISRAARRSGLLEAAYNP-AVSHRLNRTFSIELDTD--NVTNQQQSGRCWLFSTLNVVR 80  Lactobacillus delbrue...
Q1GBV8   4 ELTLQELAEFSANFNADPKNQVIARAAARSGVLEASYNE-RVAGRLTRVFSTELPTD--NVTNQKQSGRCWLFSTLNVLR 80  Lactobacillus delbrue...
Q5FMH5   4 ELTVQELEKFSADFNKNPKNKIIARAAQRSGVLEASYND-RVEGELTRVFSTELDTD--NVTNQLHSGRCWEFSTLNVLR 80  Lactobacillus acidoph...
O83150   2 YLTKELLDTFAHEVAADPIHKAVAGAVARVGLEEAALNT-EVARQHTHIFSTETKRG--EMTNQKMSGRCWIFAALNAAR 78  Treponema pallidum
2DZZ_A   8 SIDISKINSWNKEFQSDLTHQLATTVLKNYNADDALLNKtRLQKQDNRVFNTVVSTDstPVTNQKSSGRCWLFAATNQLR 87  baker's yeast
Q9W3F6  39 VITNQLLEKWRKNFYSEPKNLLAQNVCSRVDPFDVCLSR-KALETTNHVFNYKVETEgkPVTNQRSSGRCWLFAALNCIR 117 fruit fly
P87362   5 GLSTEKAAAFTRRLRAEPQFLLAQNVATCSDPLEVCLQR-QVVQDTIQVFQHAVPAEgkPVTNQKNSGRCWIFSCLNAMR 83  chicken
2CB5_A  83 LPFMKKLNIEEFEFSQSYLFFWDKVERCYFFLSAFVDTAqrKEPEDGRLVQFLLMNPANDGGQWDMLVNIVEKYGVIPKK 162 human
Q1G8V8  81 HSIQKEFKLKGFELSQSYTFFWDKFEKSNFFFENVIGSA--DKPLGDRKVSFLFATPQSDGGQWDMLCGLIEKYGIVPKK 158 Lactobacillus delbrue...
Q5FM39  81 HPLQKKFQLKDFELSQNYTNFWDKFEKSNWFFENVIATA--DKPLGDRKVSFLFATPQQDGGQWDMLCGIIEKYGIVPKS 158 Lactobacillus acidoph...
Q5M650  80 HKLISDFKLESFELSQAHTFFWDKYEKSNWFLEQIIATA--DQEIGSRKVKFLLDTPQQDGGQWDMVVSLFEKYGVVPKS 157 Streptococcus thermop...
Q9CEG3  79 HKFINEFKTEDFEFSQAYTFFWDKYEKSNWFMEQIIG----DIEMDDRRLKFLLQTPQQDGGQWDMMVAIFEKYGIVPKA 154 Lactococcus lactis su...
O69192  81 HKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETA--SEDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVPKS 158 Listeria monocytogene...
Q1GBV7  81 HNFGKANKAKNFTFSQSYNFFWDKIERANYFYDRIIATA--DRPLTDRTVRGYFDWCQTDGGQWHMAASLIAKYGVVPAY 158 Lactobacillus delbrue...
Q1GBV8  81 HDFGAKHKAKNFTLSQSYNFFWDKLERANLFYEKVIETA--DKPLDDREVRSYFDFAGHDGGQWHMAVSLVKKYGVVPSY 158 Lactobacillus delbrue...
Q5FMH5  81 HAFGKKYKAKNFTFSQAYNFFWDKIERANMFYNRILDSA--DMPLDSRQVKADLDFAGADGGQFQMAAALVEKYGVVPSY 158 Lactobacillus acidoph...
O83150  79 VNTMKKLDIETVEFSQNYLFFWDKLEKANFFLENILETL--DEPLTSRLMAHLLANPVQDGGQWDMFSGLLEKYGLVPKE 156 Treponema pallidum
2DZZ_A  88 LNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQIVSSA--DQDIDSRLVQYLLAAPTEDGGQYSMFLNLVKKYGLIPKD 165 baker's yeast
Q9W3F6 118 LPFMKNYNLDEFEFSQAFLFYWDKIERCNYFLNNVVKTAqrGEKVDGRLVSFLLLDPTSDGGQWDMLVNLITKHGLMPKK 197 fruit fly
P87362  84 LPFMKKYNIEEFEFSQSYLFFWDKVERCYYFLNAFVETAqkKEPIDGRLVQFLLTNPTNDGGQWDMLVNIVEKYGVVPKK 163 chicken
2CB5_A 163 CFPES-YTTEATRRMNDILNHKMREFCIRLR-NLVHSGATKGEISATQDVMMEEIFRVVCICLGNPP----ETFTWEYRD 236 human
Q1G8V8 159 VYPET-ANSENSRALDDTLNTMLRKGGLELR-ALVNEGKSAEEVEAHKAELLDAIFRMLATSLGLPP----KSFNFEYTD 232 Lactobacillus delbrue...
Q5FM39 159 VYPET-ANATNSSALNDTLNTLLRKDGLELR-KLVNDGKSEEEIQTRKEEMLNDVFRVLAVSLGVPP----KKFNFEYRD 232 Lactobacillus acidoph...
Q5M650 158 VYPES-VASSNSRELNQYLNKLLRQDAQILR-DLIASGADQAAVQAKKEEFLQEIFNYLAMTLGLPP----RQFDFAYRD 231 Streptococcus thermop...
Q9CEG3 155 VYPES-QASSSSRELNQYLNKLLRQDAEILR-YTIEQGGD---VEAVKEELLQEVFNFLAVTLGLPP----QNFEFAFRN 225 Lactococcus lactis su...
O69192 159 AMPET-FQSGKSADLNHLLNERLRTDAVILR-KAFTEKKD---TAGLKEEMLAEIYQLLVMTLGEPP----KVFDFEYRN 229 Listeria monocytogene...
Q1GBV7 159 SMPES-FNSNHSQALDMVLADKERKDALTLR-RLAQAGDQ-EKLEAARTDFLSQIYRIMATALGEPP----KTFDLEFRD 231 Lactobacillus delbrue...
Q1GBV8 159 VMPES-FNTSATNGLASALADKERKDALALR-RLAQAGDQ-EGLEKARKTFLNEIYRMVAIAVGEPP----KTFDLEYRD 231 Lactobacillus delbrue...
Q5FMH5 159 AMPET-FNTNNTTSFATALGDKLKKDALVLR-ELKQYGKD-DEIAKTREKFLSEVYQMTAIAVGEPP----KTFDLEYRD 231 Lactobacillus acidoph...
O83150 157 CMPET-FHSSNSRVLLAVLTRRLRKHAQLLR-SAHEEGVALHTLREKKEAFLSSIYSILVKALGRPP----EKFDFVYKD 230 Treponema pallidum
2DZZ_A 166 LYGDLpYSTTASRKWNSLLTTKLREFAETLRtALKERSADDSIIVTLREQMQREIFRLMSLFMDIPPvqpnEQFTWEYVD 245 baker's yeast
Q9W3F6 198 CFPES-FSCESSLRMNAILKSKLREYARNLR-VLMEKNPTDEEIACKIQEQMAEIYKVVGICLGIPS----ETFTWEYYD 271 fruit fly
P87362 164 YFPES-HTTEATRRMNEILNHKMREYCLRLR-NMVATGTNKEELCAAMDTMIEEVFRIVSTCLGNPP----ETFCWEFRD 237 chicken
2CB5_A 237 KDKNYEKIGPITPLEFYREHVKplFNMEDKICLVNDPRPQHKHNKLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIK 316 human
Q1G8V8 233 DDGNYHIDKDITPQDFFKKYVG--WDLENYISVINGPTADKPYNKVFSVEYLGNVVGGRQVRHLNLELSKFKDLIINQLK 310 Lactobacillus delbrue...
Q5FM39 233 DDKNYHIDKDITPKEFFDKYVG--MDLEDHISTINAPTSDKPFHKVFSVEYLGNVEGGRQVRHLNLKVDEMKDLIIKQLK 310 Lactobacillus acidoph...
Q5M650 232 KDDNYQSEKGITPRAFFEKYVG--LKLSDYVSVINAPTADKPYGKSYTVEMLGNVVGAPSVRYINLPMDRFKELAIAQMK 309 Streptococcus thermop...
Q9CEG3 226 KDNEYKKFVG-SPKEFYNEYVG--IDLNNYVSVINAPTADKPYNKSYTVEFLGNVVGGKEVKHLNVEMDRFKKLAIAQMQ 302 Lactococcus lactis su...
O69192 230 KDNEFKQELQITPKDFYERYVD--MDLKNYIPLINAPTKDKPFNQAFTVDYLGNIVNGTPIKYLNVEMDVLKKAATDQIK 307 Listeria monocytogene...
Q1GBV7 232 DDKNYHLDKGLTPVQFYKKYCA--TDLDDYVVLANAP--DHEMNRVLHLGFEDNIKGGYPNLFINVPMEYLEDAAIAQLK 307 Lactobacillus delbrue...
Q1GBV8 232 DDKNYHLEKNLTPVSFFNKYFD--VDLDDYVVLTNAP--DHEYGKLYHLGAEDNVEGGSPILFLNVPMEYLEQAAVAQLK 307 Lactobacillus delbrue...
Q5FMH5 232 DDKKYHLDKNLTPLEFLHKYMGe-VDFDDYVVLTNAP--DHEYNKLYGLPAEDNIEGSLRIKLLNVPMEYLSSAAIAQLK 308 Lactobacillus acidoph...
O83150 231 KEKKFHKVRDLTPQKFFCDFVG--WDLKNKVSLIHAPTADKPFGRAYTVKFLGTVKEAPCICYVNTPIEVLKEATASAIR 308 Treponema pallidum
2DZZ_A 246 KDKKIHTIKS-TPLEFASKYAK--LDPSTPVSLINDP--RHPYGKLIKIDRLGNVLGGDAVIYLNVDNETLSKLVVKRLQ 320 baker's yeast
Q9W3F6 272 KSKNYQSIGPVSSLEFYERYVKphFNVEDKVCLVTDPRPTSSYDQAYTVDCLGNVVGGRPVLYNNQSVELLLAVVTKSLK 351 fruit fly
P87362 238 KEKNYHKFGPMTPVQFYNEHVKpyFNMEDKVCLVNDPRPQNPYCQLYTVEYLGNMAGGRKTLYNNQPIEVLKKLAATSIK 317 chicken
2CB5_A 317 DGEAVWFGCDVGKHFNSKLGLSDMNLYDHELVFGVSLKNm-NKAERLTFGESLMTHAMTFTAVSEkDDqdGAFTKWRVEN 395 human
Q1G8V8 311 QGEVVWFGSDVSKGGDREAGLLDTKIYQRDQLFDYDFSM--SKADRLDSGESMMNHAMVITAVDL-VD--DKPTKWKIEN 385 Lactobacillus delbrue...
Q5FM39 311 SGEVVWFGSNVVKDSERRAGLLDTDLYRRDELFDVDFSM--SKAEKLDSGESMMDHAMVITGVDI-VD--GKPTKWKIEN 385 Lactobacillus acidoph...
Q5M650 310 AGESVWFGSDVGQVSDRQKGILATNVYDFTASMDINWTQ--DKAGRLDYSESLMTHAMVLTGVDLdAD--GKPIKWKIEN 385 Streptococcus thermop...
Q9CEG3 303 AGETVWFGCDVGQESNRSAGLLTMDSYDFKSSLDIEFTQ--SKAGRLDYGESLMTHAMVLAGVDLdAD--GNSTKWKVEN 378 Lactococcus lactis su...
O69192 308 DGETVWFGCDVGQLSEKTTGIMDTDIFLLNQTFGFKTAM--TKAERLDYKHSMLTHAMVLTGVNV-AN--GEVNRWKVEN 382 Listeria monocytogene...
Q1GBV7 308 DGEAVWFGNDVGRQMDRKTGFMDLDLYQLDQLLDIDSHL--SKADRLATGIGESSHDMALVGVDV-DG--GQVRQWKVEN 382 Lactobacillus delbrue...
Q1GBV8 308 DGEAVWFGNDVGRQMDHKTGYLDTDLYKLEDLFAVDLSL--SKADRLATGVGEVSHAMTLVGVDE-DK--GDIRQWKVEN 382 Lactobacillus delbrue...
Q5FMH5 309 DGEAVWFGNDVLRQMDRKTGYLDTNLYKLDDLFGVDLKM--SKADRLRTGVGEVSHAMTLVGVDE-DN--GEIRQWKVEN 383 Lactobacillus acidoph...
O83150 309 AGEPVWFGCDVGQMMTRKDGIMDTEIFGYESMLGTTPEF--NKAERLDYGESLLTHAMVITGFDEdAQ--GNPVRWQVEN 384 Treponema pallidum
2DZZ_A 321 NNKAVFFGSHTPKFMDKKTGVMDIELWNYP-AIGYNLPQ--QKASRIRYHESLMTHAMLITGCHVdETs-KLPLRYRVEV 396 baker's yeast
Q9W3F6 352 AGEAVWFGCEVSKRFASKQGIEDVDVHDFKLVFDIDIQTtfSKADRLIYGESAMTHAMVFTAVSVdKS--GVAQKLRVEN 429 fruit fly
P87362 318 DGEAVWFGCDVAKHFYSKLGINDLNIFNHELVFGVSVKNm-NKAERLIFGDSLMTHAMVLTAVSEkDGqeDCYEKWRVEN 396 chicken
2CB5_A 396 SWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQ---EPIILPAWDPMG 450 human
Q1G8V8 386 SWGDKPGFKGYFVMSDEWFDQFVYQAVLNKAFLPEDVKKAYDEgkeNPIELLPWDPMG 443 Lactobacillus delbrueckii subsp. bulgaricus...
Q5FM39 386 SWGEKPGFKGYFVMSDKWFDSFVYQAVINKKFLPDDLKKAYDEgvkDPIQLLPWDPMG 443 Lactobacillus acidophilus
Q5M650 386 SWGDKVGQKGYFVASDAWMDEYTYQIVVRKDFLTAEELAAYEA---DPQVLAPWDPMG 440 Streptococcus thermophilus LMG 18311
Q9CEG3 379 SWGKDAGQKGYFVASDEWMDEYTYQIVVRKDLLTEEELAAYEE---KPQVLLPWDPMG 433 Lactococcus lactis subsp. lactis Il1403
O69192 383 SWGEKIGNNGYFVASDAWMDEFTFQVVVHKKYLSKELIEAFNQ---EPIALKPWDPMG 437 Listeria monocytogenes EGD-e
Q1GBV7 383 SWGDKSGEKGYFTMSADWFREYTYEVAVQKKHVPAEILDLLKN---QPIELDPWDSLi 437 Lactobacillus delbrueckii subsp. bulgaricus...
Q1GBV8 383 SWGDKSGEKGFFVMSHNWFKEYVYEVVVHKKYLTKDQQELLSS---TPVELAPWDSLA 437 Lactobacillus delbrueckii subsp. bulgaricus...
Q5FMH5 384 SWGEKSGSKGFFVMSNDWFNDYVYEVVVHKKYLTDKQKELAEG---PITDLPAWDSLA 438 Lactobacillus acidophilus
O83150 385 SWGDDTGKKGMFSMSDRWFDEYLYQITIDKKFVPQVWLDALEK---PIIALEPWDPMG 439 Treponema pallidum
2DZZ_A 397 SWGKDSGKDGLYVMTQKYFEEYCFQIVVDINELPKELASKFTSgkeEPIVLPIWDPMG 454 baker's yeast
Q9W3F6 430 SWGEDRGEKGYLVMNADWFREFGFEVVVDKKYVPEDVLRVFDM---DPIVLPAWDPMG 484 fruit fly
P87362 397 SWGEDRGNKGYLIMTDDWFSEYVYEVVVDKKYVPEDVLAVMEQ---EPIVLPAWDPMG 451 chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap