1NLM


Conserved Protein Domain Family
Glyco_transf_28

?
pfam03033: Glyco_transf_28 
Click on image for an interactive view with Cn3D
Glycosyltransferase family 28 N-terminal domain
The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
Statistics
?
PSSM-Id: 281083
View PSSM: pfam03033
Aligned: 26 rows
Threshold Bit Score: 86.5676
Threshold Setting Gi: 511264181
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NLM_B          9 LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRw--LGTADRMEADLvPKHGI--EIDFIRIS---------GLRGk-gIKAL 74
gi 81540337     3 aILIAIGSAGDVFPFIGLARTLKLRGHRVS---LCTIPVFRDAV-EQHGI--AFVPLSDEl--------TYRRt-mGDPR 67
gi 75267569   158 IAILVVGTRGDVQPFLAMAKRLQEFGHRVR---LATHANFRSFV-RAAGV--EFYPLGGDprelaaymaRNKGl--IPSG 229
gi 74852522  1166 ITILTIGSRGDIQPFIALSLGLKEYGHNVT---LATHELYRDLIsKEFGL--NYQPLGGDprel--mdlCVRNgifTPKF 1238
gi 73619400  1017 ITLLTIGSRGDVQPYIALGKGLVKEGHNVT---IATHAEFGDWI-KTFGL--GFKEIAGDpaelmsfmvTHNSm--SVGF 1088
gi 73619423   742 FGLLTIGSRGDVQPYIALGKGLIKEGHQVV---IITHSEFRDFV-ESHGI--QFEEIAGNpvelmslmvENESm--NVKM 813
gi 6685676     15 VVFTGGGTGGHIFPGIAVFQALAQQA-AVRvvwIGAARGADRSIvESAGL--EFCGITAG---------KWRRy-aSVRN 81
gi 38258121     4 IVFTGGGTVGHVTLNLLLMPKFIEDGWEVHy--IGDKRGIEHQEiLKSGLdvTFHSIATG---------KLRRy-fSWQN 71
gi 75264865   195 IVMLIVGTRGDVQPFVAIAKRLQDYGHRVR---LATHANFKEFV-LTAGL--EFYPLGGDpkvlagymvKNKGf--LPSG 266
gi 511264181    3 VLLSVCGTRGDVEIAVSLAVRLKALGVGTR---MCAPPAAAERL-AEVEV--PHVPVGLP---------QHMMl--QEGM 65
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
1NLM_B         75 IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQ 147
gi 81540337    68 LWDPKTS--FGVLWQAIAGMIEPVYEYVSAQRHDDIVVVGSLWALGARIAHEKYGIPYLSAQVSPSTLLSAhl 138
gi 75267569   230 PSEISKQRKQLKAIIESLLPACIEPDLETATSFRAQAIIANPPAYGHVHVAEALGVPIHIFFTMPWTPTNEFP 302
gi 74852522  1239 IKEALSR-------FRSFIDDLLLTCWKAVQNSNTQVLIATPGCFAGPHIGEVLQIPFFNAFTMPFTRTRTYP 1304
gi 73619400  1089 LKNAQQK-------FRSWISKLLTTSWEAC--QGSDILIESPSAMSGIHIAEALGIPYFRAFTMPWTRTRAYP 1152
gi 73619423   814 LREASSK-------FRGWIDALLQTSWEVCNRRKFDILIESPSAMVGIHITEALQIPYFRAFTMPWTRTRAYP 879
gi 6685676     82 FFDVFRVLVGTVQSYCILRALRPQALFSKGGFVSVPPCIAAWLLRIPVVTHESDISPGLATRINARFADRILV 154
gi 38258121    72 MLDVFKVGWGIVQSLFIMLRLRPQTLFSKGGFVSVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYs 144
gi 75264865   267 PSEIPIQRNQMKDIIYSLLPACKEPDPDSGISFKADAIIANPPAYGHTHVAEALKIPIHVFFTMPWTPTSEFP 339
gi 511264181   66 PPPPPEE--ERRLAAMTVEMQFDAIPSAAEGCVAVVAVGDLAAATGVRSVAEKLGLPFFYSVPSPVYLASphf 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap