5HCN,1YR6


Conserved Protein Domain Family
ATP_bind_1

?
pfam03029: ATP_bind_1 
Click on image for an interactive view with Cn3D
Conserved hypothetical ATP binding protein
Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Statistics
?
Aligned: 32 rows
Threshold Bit Score: 111.307
Threshold Setting Gi: 81858823
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5HCN_A      7 CIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKI- 85  baker's yeast
Q9YDX8      7 VTGTAGAGKSSLVGALADRITSLGANVATLNLDPAAEKLPYDPSVDARDYVSVAELMDK-GLGPNGALVAAVDSLINHV- 84  Aeropyrum pernix
O58345      9 FVGTAGSGKTSLTGAFGEYLEEN-YKVAYVNLDTGVKELPYKPDIDVREFVTVEEIMKE-GYGPNGAIVESYD----RLm 82  Pyrococcus horikoshii
O28074      8 FTGTAGSGKTYMTKALADWFDLKKLDYLTVNLDPGADFLPYSADIDVREWFTLEDIMGRYNVGPNGAQIIGAD-LVSTLi 86  Archaeoglobus fulg...
P46577     35 VLGMAGSGKTTFVQRLTAFLHARKTPPYVINLDPAVSKVPYPVNVDIRDTVKYKEVMKEFGMGPNGAIMTCLNLMCTRF- 113 Caenorhabditis ele...
Q9V3R3     28 VLGMAGSGKTTFTQKLIQHAQ-EKFNPYVVNLDPACREVPYAAHVDIRDTVNYREVMKQYQLGPNGGIVTALNMFTTKM- 105 fruit fly
Q8W586     46 VVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGANIDIRDTVKYKEVMKQYNLGPNGGILTSLNLFATKF- 124 thale cress
O42906     13 VVGMAGSGKTTFMQQLNAHLHSKNKPPYILNLDPAVRNLPYEANIDIRDTINYKEVMKQYNLGPNGGIMTSLNLFVTKF- 91  Schizosaccharomyce...
O01426      6 VIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANC- 84  Caenorhabditis ele...
NP_012606   8 CIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKI- 86  Saccharomyces cere...
5HCN_A     86 DQV---IRLV-EQ-KK--DkfqNCIIDTPGQIECFVWSASGAIITESFAS-SFPTVIAYIVDTPRNSSPTTFMSNMLYAC 157 baker's yeast
Q9YDX8     85 --Ld-iREEI-DYySP--D---YVVVDTPGQLELFAYRVGGPLVLRGIMG-DYNGVNIFLIDSIFIDNAISLVSALLLAS 154 Aeropyrum pernix
O58345     83 NKFdyyLKEI-LElESkkD---YVLIDTPGQMETFLFHEFGVKLMENLPY----PLVVYLSDPEILRKPTDYCFVRFFAL 154 Pyrococcus horikoshii
O28074     87 DDI---RDEI-QLsSS--E---YVLIDTPGQLELFTLRESSRVLVNALN--PERSVMVYLFDPVVSKTPSGFLSMLFMAS 155 Archaeoglobus fulg...
P46577    114 DKV---IELInKRsSDf-S---VCLLDTPGQIEAFTWSASGSIITDSLAS-SHPTVVMYIVDSARATNPTTFMSNMLYAC 185 Caenorhabditis ele...
Q9V3R3    106 AQF---AELVrRAgERghK---WCVIDTPGQIEVFNWSASGSIITEGLAT-MFPTIVVYVMDVERSACPTTFMSNMLYAC 178 fruit fly
Q8W586    125 DEV---VSVIeKRaDQl-D---YVLVDTPGQIEIFTWSASGAIITEAFAS-TFPTVVTYVVDTPRSSSPITFMSNMLYAC 196 thale cress
O42906     92 DQV---LKILeKRaPTv-D---HILIDTPGQIEIFQWSASGSIICDTLAS-SWPTCIAYVVDTPRATSTSTWMSSMLYAC 163 Schizosaccharomyce...
O01426     85 NWL---LQKIeAN-HK--K---YLIIDCPGQLELYKSEGELWKVIRFLEKsGVRLCALHLADSLYCSDPSKFISVALSTL 155 Caenorhabditis ele...
NP_012606  87 DQV---IRLVeQKkDKf-Q---NCIIDTPGQIECFVWSASGAIITESFAS-SFPTVIAYIVDTPRNSSPTTFMSNMLYAC 158 Saccharomyces cere...
5HCN_A    158 SILYKTKLPMIVVFNKTDVCK---ADFAKEWMTDFESFQAAIKedqD----------GYMSSLVNSMSLMLEEFYSQlDV 224 baker's yeast
Q9YDX8    155 SVAVRLGLPQVNAVSKADMLLpevREEVIPRLGEPGFLEFLLEk-dKty-------eGAGKALAEELARAIETTGFIgEV 226 Aeropyrum pernix
O58345    155 LIDLRLGATTVPALNKVDLLKeeqLEKHRKYFEDLDYLMGRLKf-dPsm-------qGL---MAYKMCSIMMEVLPPiRV 223 Pyrococcus horikoshii
O28074    156 SAVFRLEIPQVLVLSKSDILSereLERIVEWSEDPETLYDSLNl--------------eRKTLNLELFLLLKEAGLFrPL 221 Archaeoglobus fulg...
P46577    186 SILYRTKLPFIVVFNKADIVK---PTFALKWMQDFERFDEALEd-aRs---------SYMNDLSRSLSLVLDEFYCGlKT 252 Caenorhabditis ele...
Q9V3R3    179 SILYKTRLPFLVALNKIDLKD---CGFVMDWMTDFEAFQEAQEe-eH----------SFVSNLTRTMSLTLDTFYENlRT 244 fruit fly
Q8W586    197 SILYKTRLPLVLAFNKTDVAD---HKFALEWMEDFEVFQAAIQs-dN----------SYTATLANSLSLSLYEFYRNiRS 262 thale cress
O42906    164 SMLYKAKLPLIIVYNKCDVQD---SEFAKKWMTDFEEFQQAVTk-dEgmsse-gatsGYMGSLVNSMSLMLEEFYRHlDF 238 Schizosaccharomyce...
O01426    156 ATMVTMEMPQVNCLSKADLFSed-gtYDLEFFSHLPDVNRLLDl-lNevp-----glEKYRKLNEAICGVISDFDLV-SF 227 Caenorhabditis ele...
NP_012606 159 SILYKTKLPMIVVFNKTDVCK---ADFAKEWMTDFESFQAAIKe-dQdlngdnglgsGYMSSLVNSMSLMLEEFYSQlDV 234 Saccharomyces cere...
5HCN_A    225 VGVSSFTGDGFDEFMQCVDKKVDE 248 baker's yeast
Q9YDX8    227 LQASVLEPETVTLLAAKAQQILAG 250 Aeropyrum pernix
O58345    224 LYLSAKTREGFEDLETLAYEHYCT 247 Pyrococcus horikoshii
O28074    222 IPASALTGYGMEDIYDAIQEIFYG 245 Archaeoglobus fulgidus
P46577    253 VCVSSATGEGFEDVMTAIDESVEA 276 Caenorhabditis elegans
Q9V3R3    245 CGVSAKTGVGFTQLLTKILESVDE 268 fruit fly
Q8W586    263 VGVSAISGAGMDGFFKAIEASAEE 286 thale cress
O42906    239 VSCSSVTGEGMDDFLEAVKAKVKE 262 Schizosaccharomyces pombe 972h-
O01426    228 VPLAVENKESMMKVIQMVDAANGF 251 Caenorhabditis elegans
NP_012606 235 VGVSSFTGDGFDEFMQCVDKKVDE 258 Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap