1YR6


Conserved Protein Domain Family
ATP_bind_1

?
pfam03029: ATP_bind_1 
Click on image for an interactive view with Cn3D
Conserved hypothetical ATP binding protein
Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Statistics
?
PSSM-Id: 308588
View PSSM: pfam03029
Aligned: 31 rows
Threshold Bit Score: 109.379
Threshold Setting Gi: 81858823
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YR6_A     19 FVGTAGSGKTTLTGEFGRYLED-NYKVAYVNLDTGVKELPYEPSIDVREFVTVEEIMRE-GYGPNGAIVESYDRLMEKF- 95  Pyrococcus abyssi
O01426      6 VIGAPGAGKSTFCAGLTDIFSQtKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRlGLGPNGALKYCIETLGANC- 84  Caenorhabditis ele...
Q9YDX8      7 VTGTAGAGKSSLVGALADRITSlGANVATLNLDPAAEKLPYDPSVDARDYVSVAELMDK-GLGPNGALVAAVDSLINHV- 84  Aeropyrum pernix
O58345      9 FVGTAGSGKTSLTGAFGEYLEEn-YKVAYVNLDTGVKELPYKPDIDVREFVTVEEIMKE-GYGPNGAIVESYD----RLm 82  Pyrococcus horikoshii
O28074      8 FTGTAGSGKTYMTKALADWFDLkKLDYLTVNLDPGADFLPYSADIDVREWFTLEDIMGRyNVGPNGAQIIGAD-LVSTLi 86  Archaeoglobus fulg...
P46577     35 VLGMAGSGKTTFVQRLTAFLHArKTPPYVINLDPAVSKVPYPVNVDIRDTVKYKEVMKEfGMGPNGAIMTCLNLMCTRF- 113 Caenorhabditis ele...
Q9V3R3     28 VLGMAGSGKTTFTQKLIQHAQe-KFNPYVVNLDPACREVPYAAHVDIRDTVNYREVMKQyQLGPNGGIVTALNMFTTKM- 105 fruit fly
O49703     22 VVGMAGSGKTSFLHRLVCHTFDsKSHGYVVNLDPAVMSLPFGANIDIRDTVKYKEVMKQyNLGPNGGILTSLNLFATKF- 100 thale cress
O42906     13 VVGMAGSGKTTFMQQLNAHLHSkNKPPYILNLDPAVRNLPYEANIDIRDTINYKEVMKQyNLGPNGGIMTSLNLFVTKF- 91  Schizosaccharomyce...
NP_012606   8 CIGMAGSGKTTFMQRLNSHLRAeKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENyQLGPNGAIVTSLNLFSTKI- 86  Saccharomyces cere...
1YR6_A     96 NEY---LNkilRL---------------EK-EN--DYVLIDTPGQMETFLFHEFGVRLMENLPY----PLVVYISDPEIL 150 Pyrococcus abyssi
O01426     85 NWL---LQ---KIe--------------AN-HK--KYLIIDCPGQLELYKSEGELWKVIRFLEKsgvrLCALHLADSLYC 141 Caenorhabditis ele...
Q9YDX8     85 --Ld-iRE---EI---------------DYySP--DYVVVDTPGQLELFAYRVGGPLVLRGIMGdy-nGVNIFLIDSIFI 140 Aeropyrum pernix
O58345     83 NKFdyyLK---EI---------------LElESkkDYVLIDTPGQMETFLFHEFGVKLMENLPY----PLVVYLSDPEIL 140 Pyrococcus horikoshii
O28074     87 DDI---RD---EI---------------QLsSS--EYVLIDTPGQLELFTLRESSRVLVNALNpe--rSVMVYLFDPVVS 141 Archaeoglobus fulg...
P46577    114 DKV---IE---LIn--------------KRsSDf-SVCLLDTPGQIEAFTWSASGSIITDSLASsh-pTVVMYIVDSARA 171 Caenorhabditis ele...
Q9V3R3    106 AQF---AE---LVr--------------RAgERghKWCVIDTPGQIEVFNWSASGSIITEGLATmf-pTIVVYVMDVERS 164 fruit fly
O49703    101 DEVnipLE---LVqmitdffshcvvsviEKrADqlDYVLVDTPGQIEIFTWSASGAIITEAFAStf-pTVVTYVVDTPRS 176 thale cress
O42906     92 DQV---LK---ILe--------------KRaPTv-DHILIDTPGQIEIFQWSASGSIICDTLASsw-pTCIAYVVDTPRA 149 Schizosaccharomyce...
NP_012606  87 DQV---IR---LVe--------------QKkDKf-QNCIIDTPGQIECFVWSASGAIITESFASsf-pTVIAYIVDTPRN 144 Saccharomyces cere...
1YR6_A    151 KKPNDYCFVRFFALLIDLRLGATTIPALNKVDLLSeeeKERHRKYFEdidyltarl----------kldpsmqglMAYKM 220 Pyrococcus abyssi
O01426    142 SDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSed-gtYDLEFFShlpdvnrlldll-----nevpglekyrkLNEAI 215 Caenorhabditis ele...
Q9YDX8    141 DNAISLVSALLLASSVAVRLGLPQVNAVSKADMLLpevREEVIPRLGepgflefllek-------dktyegagkaLAEEL 213 Aeropyrum pernix
O58345    141 RKPTDYCFVRFFALLIDLRLGATTVPALNKVDLLKeeqLEKHRKYFEdldylmgrl----------kfdpsmqglMAYKM 210 Pyrococcus horikoshii
O28074    142 KTPSGFLSMLFMASSAVFRLEIPQVLVLSKSDILSereLERIVEWSEdpetlyds-------------lnlerktLNLEL 208 Archaeoglobus fulg...
P46577    172 TNPTTFMSNMLYACSILYRTKLPFIVVFNKADIVK---PTFALKWMQdferfdeale---------darssymndLSRSL 239 Caenorhabditis ele...
Q9V3R3    165 ACPTTFMSNMLYACSILYKTRLPFLVALNKIDLKD---CGFVMDWMTdfeafqeaq----------eeehsfvsnLTRTM 231 fruit fly
O49703    177 SSPITFMSNMLYACSILYKTRLPLVLAFNKTDVAD---HKFALEWMEdfevfqaai----------qsdnsytatLANSL 243 thale cress
O42906    150 TSTSTWMSSMLYACSMLYKAKLPLIIVYNKCDVQD---SEFAKKWMTdfeefqqavtkdeg-mssegatsgymgsLVNSM 225 Schizosaccharomyce...
NP_012606 145 SSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCK---ADFAKEWMTdfesfqaaikedqdlngdnglgsgymssLVNSM 221 Saccharomyces cere...
1YR6_A    221 CSMMTEVLPPvRVLYLSAKTREGFEDLETLAYEHYCT 257 Pyrococcus abyssi
O01426    216 CGVISDFDLV-SFVPLAVENKESMMKVIQMVDAANGF 251 Caenorhabditis elegans
Q9YDX8    214 ARAIETTGFIgEVLQASVLEPETVTLLAAKAQQILAG 250 Aeropyrum pernix
O58345    211 CSIMMEVLPPiRVLYLSAKTREGFEDLETLAYEHYCT 247 Pyrococcus horikoshii
O28074    209 FLLLKEAGLFrPLIPASALTGYGMEDIYDAIQEIFYG 245 Archaeoglobus fulgidus
P46577    240 SLVLDEFYCGlKTVCVSSATGEGFEDVMTAIDESVEA 276 Caenorhabditis elegans
Q9V3R3    232 SLTLDTFYENlRTCGVSAKTGVGFTQLLTKILESVDE 268 fruit fly
O49703    244 SLSLYEFYRNiRSVGVSAISGAGMDGFFKAIEASAEE 280 thale cress
O42906    226 SLMLEEFYRHlDFVSCSSVTGEGMDDFLEAVKAKVKE 262 Schizosaccharomyces pombe 972h-
NP_012606 222 SLMLEEFYSQlDVVGVSSFTGDGFDEFMQCVDKKVDE 258 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap