1FXK


Conserved Protein Domain Family
Prefoldin

?
pfam02996: Prefoldin 
Click on image for an interactive view with Cn3D
Prefoldin subunit
This family comprises of several prefoldin subunits. The biogenesis of the cytoskeletal proteins actin and tubulin involves interaction of nascent chains of each of the two proteins with the oligomeric protein prefoldin (PFD) and their subsequent transfer to the cytosolic chaperonin CCT (chaperonin containing TCP-1). Electron microscopy shows that eukaryotic PFD, which has a similar structure to its archaeal counterpart, interacts with unfolded actin along the tips of its projecting arms. In its PFD-bound state, actin seems to acquire a conformation similar to that adopted when it is bound to CCT.
Statistics
?
Aligned: 36 rows
Threshold Bit Score: 69.963
Threshold Setting Gi: 1175932
Created: 1-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FXK_C  13 YQSQVELIQQQMEAVRATISELEILEKTLSDIQgk--------dGSETLVPVGAGSFIKAEL-KDTSEVIMSVGAGVAIK 83  Methanothermobacter t...
Q8T965  58 YSELAAKLETDLTAVLTRLEAAKNNLELVRRFIdnp------dkEVHSLVQIAQGVFRWVSI-PPVQKVTLQVGASLQME 130 fruit fly
O28216  17 LQEEAEALQRRLMELEILENEYRKTLETLEFFEsi-------dtSVEALMNLGGGVFAYVDV-KNSKKMLVDIGSGVVVE 88  Archaeoglobus fulgidu...
Q8VZL7  20 LKQKLVHATASRDKIFEEQKTLSDLRKNLETLEkng------vnSLKTRVNLGSEVYMQAEV-PDTRHIFMDVGLGFYVE 92  thale cress
Q20070  23 IHPKIATEEKEFKKLQKQCEEYAKLKFTCQRLLnea------pkTTEGKTELGQRVFMNIEV-RDTKHVVVKLCDDVYVE 95  Caenorhabditis elegans
Q9VJP9  35 LKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDthl------pdGYKTQVNIGSNVFMQARV-RKMDSILVDVGKNVFLD 107 fruit fly
Q21993  25 CEQELNFFQESFNALKGLLTRNEKSISALDDVKia-------taGHTALIPLSESLYIRAEL-SDPSKHLVEIGTGYFVE 96  Caenorhabditis elegans
P43573   8 VESTLKNLQDKRNFLSEQREHYIDIRSRLVRFIndnddgeeegeGQGMVF---------GDIiISTSKIYLSLGYEYYVE 78  Saccharomyces cerevis...
Q966M4   9 CNAAKARLEVETECRRIIADNYEKVLERAKEYSkk--------lEAPILAKICEVGYFCGAHvVRTNQVTMEMGANYYGE 80  Caenorhabditis elegans
Q9W148   8 LLQALQTNASETERWEAFKRDNESTIRNLDKFAkn--------lSVEVMVPIGRKALMPGEL-IHTNELLVGHYEGYFSA 78  fruit fly
1FXK_C  84 KNFEDAMESIKSQKNELESTLQKMGENLRAITDIMMKLSPQAEEL 128 Methanothermobacter thermautotrophicus
Q8T965 131 FELSEAEEFIKKDITSLVKQQLQHEHDIDYLQDQVNTIEMNLAVL 175 fruit fly
O28216  89 REVGEAIEFVKNRIKKIEENQEKMTSMLQQVLSQAQRIQQELAAR 133 Archaeoglobus fulgidus DSM 4304
Q8VZL7  93 FTRQEALDYIAQREERTQKQLEEYTGVITQIKGRIKLAHYQIQQI 137 thale cress
Q20070  96 MKLQDAIKTCDRKMDSLKNMMEKLQKSTNKLKTDLTMLLATMDMP 140 Caenorhabditis elegans
Q9VJP9 108 MSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALIAISER 152 fruit fly
Q21993  97 LDREKAKAIFDRKKEHITKQVETVEGILKEKRRTRAYISDAFQTK 141 Caenorhabditis elegans
P43573  79 KTKEEAITFVDDKLKLMEDAIEQFNLKIEEAKKTLDNLNHMEDGN 123 Saccharomyces cerevisiae S288C
Q966M4  81 CSIHTAEKILDRRVSEMRRQREEGLDSIRMLDDKIKFAQDNFSSV 125 Caenorhabditis elegans
Q9W148  79 CSSHKAKEICQYRLKLAEEQLKKLAVENDLWQKKLHTPFAEGAVP 123 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap