1GLV


Conserved Protein Domain Family
GSH-S_ATP

?
pfam02955: GSH-S_ATP 
Click on image for an interactive view with Cn3D
Prokaryotic glutathione synthetase, ATP-grasp domain
Statistics
?
PSSM-Id: 308550
View PSSM: pfam02955
Aligned: 32 rows
Threshold Bit Score: 240.532
Threshold Setting Gi: 81397853
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GLV_A 124 EKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPA 203 Escherichia coli
Q7U3W8 119 EKLGALRFSRWMAPTLVAGRVSELMAFAREQGDVVLKPLGGRAGLGVIRVQAEAPGLKALLELVTEQERLPVMAQRFLPD 198 Synechococcus sp. WH ...
Q7NF44 128 EKLYALHFPDLVPETRVCTHRQDILDFVDIHGRAVIKPLDGKGGEGIFLLARADRNLNAIIEASTAYGTRHVMVQRYLEE 207 Gloeobacter violaceus...
P73493 132 EKMYTLQFAAVMPPTVVSLDKGLIRQFLEEHGAAVLKPLGGKAGEGILFLDPGDRNFNSLVEISTQHGKEPVMVQRFLPE 211 Synechocystis sp. PCC...
P45480 132 EKMYALQFTKAIPETIVSADKDFIRQFVEAKGATVLKPLGNKAGEGILFLQAGDRNFNSIVELSTQQGRLPVMVQTYLPE 211 Nostoc sp. PCC 7120
O32463 132 EKMYALQFQSVVPRTLVSSNKAEIRAFLDELRAAVLKPLGGKAGEGILFLDPGDRNFNSLVEISTQQGQLPVMVQQYLPE 211 Synechococcus elongat...
Q9ABS9 125 EKLFVTDFPGVQPPTLITSDHEAIYDFRARHGDIVLKPLYGGGGSGVARLLADDPNLDALLELHAMIGREQVIAQKFVPA 204 Caulobacter crescentu...
P61396 124 EKLFVMDFTELMPPTLISRDKDEINAFRAEHGAVVMKPLHGHGGAAVFRVLPQDINFGSLYDMFAVTFREPWVIQRFLPE 203 Rhodopseudomonas palu...
Q2KDE2 126 EKIFVTEFSDLMPKTLITKDPAEIRRFRDEMGDIILKPLYGNGGAGVFHSTRDDRNLSSLLEMFGQLFREPFIAQQYLPD 205 Rhizobium etli CFN 42
Q2YQU6 124 EKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNLTSLLEMFGQLFREPFIAQRYLKD 203 Brucella abortus 2308
1GLV_A 204 IKDGDKRVLVVDGEPVPyCLAR-------------GGGGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEIN 270 Escherichia coli
Q7U3W8 199 VTEGDKRILLVDGDPLG-AVNRrpsegefrsnlavGGQAEATELSEPERQICAALAPALRAEGLFFVGIDVIGGMLSEIN 277 Synechococcus sp. WH ...
Q7NF44 208 SRQGDKRIVLLAGEPIG-ALLRvpreddvrgnmaaGGRVVKTTLTERDREICRVVGPRLVADGHYFVGIDVIGAYLTEIN 286 Gloeobacter violaceus...
P73493 212 AKEGDKRIILLDGDPIG-AVNRipsgaefrgnmavGGQVAPTTITSREIEICALLKPKLQADGLYFVGIDVIGGYLTEVN 290 Synechocystis sp. PCC...
P45480 212 AKEGDKRIILLNGEPIG-ALNRlasgsdfrnnmatGGTVAKTEITPREEEICSQIAANLRQDGLIFVGIDVIGGYLTEVN 290 Nostoc sp. PCC 7120
O32463 212 AKDGDKRIILVNGEPLG-AVNRvptgrefrgnmavGGRVEAVPITDRDREICAAVAPRLRQDGLFFVGIDVIGGYLTEVN 290 Synechococcus elongat...
Q9ABS9 205 VSKGDKRVLLVDGEPVG-AINRvpasgqvrsnlrvGGRAEAVELTARDLELCKIIAPELKRRGLLFVGIDVIGEYLTEIN 283 Caulobacter crescentu...
P61396 204 VKHGDKRIILVDGEFAG-AVNRvpaeddlrsnmvrGGAAAATELSPREREICATLGPKLRERGLLFVGIDVIDGYLTEIN 282 Rhodopseudomonas palu...
Q2KDE2 206 VRKGDKRIILVDGEFAG-AINRvpaehdsrsnmhvGGRAEATELTAREKEICERIGPALRERGFLLVGIDVIGDYMTEIN 284 Rhizobium etli CFN 42
Q2YQU6 204 VRAGDKRIILIDGEPVG-ALNRvpsetdarsnmhvGGRPEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEIN 282 Brucella abortus 2308
1GLV_A 271 VTSPTCIREIEAE 283 Escherichia coli
Q7U3W8 278 VTSPTGVREVERL 290 Synechococcus sp. WH 8102
Q7NF44 287 VTSPTGICEIDVL 299 Gloeobacter violaceus PCC 7421
P73493 291 VTSPTGIREIDRL 303 Synechocystis sp. PCC 6803 substr. Kazusa
P45480 291 VTSPTGIREIDRL 303 Nostoc sp. PCC 7120
O32463 291 VTSPTGIREIDRL 303 Synechococcus elongatus PCC 7942
Q9ABS9 284 VTSPTGAQQLKRF 296 Caulobacter crescentus CB15
P61396 283 VTSPTGIRAVARL 295 Rhodopseudomonas palustris CGA009
Q2KDE2 285 VTSPTGIREVKKF 297 Rhizobium etli CFN 42
Q2YQU6 283 VTSPTGIREIERF 295 Brucella abortus 2308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap