1OIS,1R49,2B9S


Conserved Protein Domain Family
Topoisom_I_N

?
pfam02919: Topoisom_I_N 
Click on image for an interactive view with Cn3D
Eukaryotic DNA topoisomerase I, DNA binding fragment
Topoisomerase I promotes the relaxation of DNA superhelical tension by introducing a transient single-stranded break in duplex DNA and are vital for the processes of replication, transcription, and recombination. This family may be more than one structural domain.
Statistics
?
Aligned: 140 rows
Threshold Bit Score: 261.628
Threshold Setting Gi: 118193909
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OIS_A         3 IKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPVFQKNFFNDFLQVL--KESGgp 80   baker's yeast
EGD78186     247 qYWRTLEHRGPMFAPPYQPLPKDVYLLYDGKPYHFEPAAEEVATFYAAMLERDYVKKPVFNKNFFADWKTTMtaQEKKd- 325  Salpingoeca ro...
EDV21656      10 VKWKTLEHKGPLLAPPYERLPSNVQFYYDGQTFPLSDKTEEAAGFYAKMLDHDYTQKKIFNDNFWTDFRKEMtpAEKNh- 88   Trichoplax adh...
3_pfamImport   1 ------EHKGPYIVPLYEPFRGEVHFYYDAKLNFIVFPIEEIATF-GEMLGHEYTTKEVFQNDFFNNWQKEMavDKKKi- 72  
XP_006634230 361 tKWQFLEHKGPLFASEYEPLPENVKFYYSGKPVKLSLTAEEVAVFYAKMLDHEYTTKEVFQKNFFHDWKQEMtaEEQSl- 439  spotted gar
XP_011674381 406 VKWMFLEHTGPLFAPPYEPLPNSVKFFYDGEEMKLSEEAEEVAGFYARMIEHDYTTKDVFNNNFYRDWKKVMthEEKAi- 484  purple sea urchin
XP_022529630  47 QKWSTLEHNGPLFPPEYEPLPSNVPFLYDGEPVKLSLATEEVATFYAKMLDHEYTTKEIFQNNFFTDWREVMteSERRl- 125  Mexican tetra
XP_020850520  61 VKWKQLEHKGPYFAPLYEPLPDEVHFYYDGNAMKLSLATEEIATFYGKMLDHEYTTKEVFQNNFFNDwrKEMtvEEKKi- 139  koala
XP_015138653  24 VKWKQLEHKGPYFVPLYEPLPDDVQFYYDGKPLKLSLATEEIATFYAKMLDHEYTTKEIFQNNFFNDWRKEMtpQEQEi- 102  chicken
XP_014352319  46 VKWKFLEHKGPYFAPPYEPLPEDVPFYYDGKLMKLSPETEEIATFYAKMLDHEYTTKEVFQKNFLHDWRQEMtsEERKa- 124  coelacanth
1OIS_A        81 lngieIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRLEREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRG-AH 159  baker's yeast
EGD78186     326 -----IKDLKKCDFSLIHRFLKQRAEERKGASKEEKQKRKEENDKIKQEYGFAIIDGRRAPVGNFKIEPPGLFQGRG-EH 399  Salpingoeca ro...
EDV21656      89 -----IKVFSKCDFSKIAEYYKMKAEERRNMSKEEKNKLKKENEELMQEYGFCIIDGHRQRVGNFKIEPPGLFRGRG-DH 162  Trichoplax adh...
3_pfamImport  73 -----IKPLDKYDFTEIHKYF--------SLPKEETQKLKEDAERLQEEFGYYILDGHREK-GNFK-KSPGLFCDYG--H 135 
XP_006634230 440 -----IKDLSKCDFKEIHQYFEKKTEEKKAMTKEGKQALKKAAEMVTEEYGYCLLDGHREKIGNFKIEPPGLFRGRG-DH 513  spotted gar
XP_011674381 485 -----IKDMKKCNFKQIHAYYQRKSEERKAMSKEEKQENKRKNEEIQKEYGFCSFDGHKEKIGNFRVEPPSLFRGRG-EH 558  purple sea urchin
XP_022529630 126 -----IKKLSKCDFSSIHKYFVEKAEEKKNMTKEEKQVLKDEANKLTEHYGYCLLDGHKEKIGNFRVEPPGLFRGRG-EH 199  Mexican tetra
XP_020850520 140 -----IKRLDKCDFTEIHKYFVDKNEArKALPKEEKQKLKEEADRLQEEFGYCILDGhREKIGNFKTEPPGLFRGRGdH- 213  koala
XP_015138653 103 -----IKQLDKCDFREIHKYFVDKNEARKALSKEEKQKLKEEADKIQEEYGYCILDGHREKIGNFKTEPPGLFRGRG-DH 176  chicken
XP_014352319 125 -----IKDLQKCDFTRIHKYFVDNNEARKALPKEEKQKLKEVNKIIQEEYGYCVMDGHQEKIGNFKVEPPGLFRGRG-DH 198  coelacanth
1OIS_A       160 PKTGKLKRRVNPEDIVLNLSKDAPVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRL 221  baker's yeast
EGD78186     400 PKMGKLKRRVLPEQVIINIGKEAKVPEPPAGHRWKEVRHDNKVSWLAAWVENIQKSNKYVML 461  Salpingoeca rosetta
EDV21656     163 PKQGKIKRRIEAKDIIINIGKDAKLPAPPPGQKWKEVRYDNKVTWLASWTENINGSIKYIML 224  Trichoplax adhaerens
3_pfamImport 136 SKIEMLKKRIMP-DVIINCSKD-KLPEPLPGLKWKEVCFDKTFTWLVSWTKKVHNSIKYIML 195 
XP_006634230 514 PKMGKLKRRIQPEDVIINCSKESKIPVPPQGHKWKKVQHDNTVTWLASWVENVQGGIKYIML 575  spotted gar
XP_011674381 559 PQTRSAQEGIGPEDVIINCSKDSKWPIPPEGHKWKKVIHENSVTWLASWTENIQGAIKYVML 620  purple sea urchin
XP_022529630 200 PKMGKLKKRVQPEDVIINCSQDAKIPDPPVGHRWKRVQHDNSVTWLASWVENIHAHIKYIML 261  Mexican tetra
XP_020850520 214 PKMGMLKKRIMPEDVIINCSRDSKIPEPPPGHKWKEVRFDNTVTWLASWTENIQNSIKYIML 275  koala
XP_015138653 177 PKMGMLKKRIMPEDVIINCSKDSKIPEPPVGHKWKEVRFDNTVTWLASWTENIQNSLKYIML 238  chicken
XP_014352319 199 PKMGMLKKRIMPEDVIINCSKGSKVPEPPASHKWKEVRHDDKVTWLASWTENIQGSIKYVML 260  coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap