3I2D


Conserved Protein Domain Family
zf-MIZ

?
pfam02891: zf-MIZ 
Click on image for an interactive view with Cn3D
MIZ/SP-RING zinc finger
This domain has SUMO (small ubiquitin-like modifier) ligase activity and is involved in DNA repair and chromosome organisation.
Statistics
?
Aligned: 33 rows
Threshold Bit Score: 73.8242
Threshold Setting Gi: 122052608
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3I2D_A    248 MSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQID 297  baker's yeast
Q680Q4    359 VNLRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKN 408  thale cress
Q4D897    311 VTLRCPLSYQRIRVAGKGKHCVHLACFDVVTYLESSLRSSTWNCPICDGP 360  Trypanosoma cruzi
Q38DR7    457 ITTKCPISQARISIPIRGAHCAHLQCFDCRSFLQGCHSGCYWNCPLCDSP 506  Trypanosoma brucei
Q4E4T0    410 ITSKCPILQTRINIPVRGSRCQHLQCFDCLSFLLSCNKGCYWNCPLCDAE 459  Trypanosoma cruzi
CBZ13026  500 ITTKCPISQLPLSVPVRGSRCTHLQCVDLNAFLVSSNKASYWNCALCDAE 549  Leishmania major strain Friedlin
Q4CSC6    405 VKINCPITTLPLSIPVRGHLCEHMQCVELRSLLMQCARTNVWNCPLCWAP 454  Trypanosoma cruzi
Q586F5    424 VRAVCPITALPLSVPVRACGCEHVQCIELQAVLMHCDRTNVWNCPLCWAP 473  Trypanosoma brucei
Q555X5    473 LTVRCPLSFKRIEYPAKSKKCTHNQCFDLCSFTEYSNQQQLWNCPICHAV 522  Dictyostelium discoideum AX4
Q54V57    820 ITVRCILKNSRMILPIKSENCTHHQCFDLRNYLKHCQKIQLWNCPICNVP 869  Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap