Conserved Protein Domain Family
DDHD

?
pfam02862: DDHD 
DDHD domain
The DDHD domain is 180 residues long and contains four conserved residues that may form a metal binding site. The domain is named after these four residues. This pattern of conservation of metal binding residues is often seen in phosphoesterase domains. This domain is found in retinal degeneration B proteins, as well as a family of probable phospholipases. It has been shown that this domain is found in a longer C terminal region that binds to PYK2 tyrosine kinase. These proteins have been called N-terminal domain-interacting receptor (Nir1, Nir2 and Nir3). This suggests that this region is involved in functionally important interactions in other members of this family.
Statistics
?
PSSM-Id: 335128
View PSSM: pfam02862
Aligned: 153 rows
Threshold Bit Score: 86.7903
Threshold Setting Gi: 384485021
Created: 21-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8IAY0       225 KIHYLFMLGSPLSALLSLYkpeyindGLKlnnGL---------------------------------------------K 259 Plasmodium falc...
Q6BJ29       557 DVDDLFCVGSPIGVFKLLG-------QTN---IKprsllpsdydas----------------------qkntfaspkcsN 604 Debaryomyces ha...
EXX68536     508 EVTNFFAAGSPVGLFLLLK-------GLK---VAsrkdrinhqmkqnfsqtlagaamemgismdlplnnsiplcypavkN 577 Rhizophagus irr...
ESA19348     499 PVWNFFAAGSPIGLFLMLK-------GLK---IGsrkylvdaekisgankk------------kskittsipycypavkN 556 Rhizophagus irr...
EPB83576     549 PVKNYFALGSPLGMIMLLR-------GNK---MVsrktlteppskqn-------------------ndnpvsfvypaadN 599 Mucor circinell...
EIE77626     172 PVRNFFAVGSPLGMILLLR-------SYK---IVsrkalttntapnhvntps----------snktpsslvsfvypaadN 231 Rhizopus delema...
XP_011274216 557 KVDNYFALGSPIGVFNLLK-------RKN---IGsvelhensn---------------------------ekisvprceN 599 Wickerhamomyces...
XP_002489432 473 KVENYFALGSPLGVFSLLK-------RQN---IAprseenlvsvndid-----------------kevlerpcvgpkceN 525 Komagataella pa...
XP_006684607 537 DVDSLFCVGSPVGVFKLIS-------QKN---IVnrsdvpkdfdpr---------------------srslsysspkckN 585 Candida tenuis ...
CCE78969     533 DVENLFCVGSPIGVFKLIS-------KKN---IVprsmvpsdfdvn---------------------ddslpydspkcqN 581 Pichia farinosa...
Q8IAY0       260 FYNIFHGFDPVAFRIEPLIYPGI-KNIpEPVLINYWRNnGARywfEWDKNMQNA-------KLAIVQNLNDFTSAItngf 331 Plasmodium falc...
Q6BJ29       605 LYNIFHPCDPIGYRMEPLINPEF-SNF-KPELVPFAVK-GLN---TQIKELAHF-------SEEIQEKLlra-------- 663 Debaryomyces ha...
EXX68536     578 LYNIFHNADPIAYRLEPLIARQYgSSL-KPALIPYHKG-----------GLKGMhlgfqefGNEIASKATNILSSVktsl 645 Rhizophagus irr...
ESA19348     557 LYNLFHKADPIAYRIEPLVSRRYtTSL-KPALIPYHKG-----------GLKGV-------TIGITSMFSSVFSKrkk-- 615 Rhizophagus irr...
EPB83576     600 IYNIFHKSDPVAYRLEPLVVRHYgAKL-KPVPIPYIKG-----------GLKSMldagfnaGSDLANRAGAMFESIktgf 667 Mucor circinell...
EIE77626     232 IYNIFHKSDPVAYRLEPLVVRHYgAKL-KPVPIPYIKG-----------GLKSVldagfivGNDIASKAGAMFESFksgi 299 Rhizopus delema...
XP_011274216 600 FYNVFHPCDPVGYRVEPLISPEF-KKF-QPESIPFLIE-NFN---KQLSSFAEL-------SENLSNKFigta------- 659 Wickerhamomyces...
XP_002489432 526 FYNIFHPCDSIGYRVEPLIRSEF-TKF-KPSPVPFANKsGFD---SQLKEITDF-------GDEFGDKL----------- 582 Komagataella pa...
XP_006684607 586 LYNLYHPCDPIGYRIEPLIKPRF-AHF-KAQEAPFAAD-GLE---TPFKGWSTL-------TDELQERFska-------- 644 Candida tenuis ...
CCE78969     582 IYNLFHPCDPVGYRMEPLINPKF-AIM-KPESVPFASQ-GIN---TQIKGLSDL-------GDEIQDKIika-------- 640 Pichia farinosa...
Q8IAY0       332 ------------------ykfLGKNenndedqstlnknicynkceskdiniflLKVKENQRKialQKKKIHRYNkknnit 393 Plasmodium falc...
Q6BJ29       664 ------------------sswFNRG----------------------------NNTDKKKTEe----------------- 680 Debaryomyces ha...
EXX68536     646 mftkgfqsiipqsnsninnslLKRS----------------------------TSMPNNTSGennENNSGSALTnypptn 697 Rhizophagus irr...
ESA19348     616 ------------------sttSSSS----------------------------SSATNSRSGsmdVSRKSIDESqittin 649 Rhizophagus irr...
EPB83576     668 -----------------tsslLMRG----------------------------LGFSKPLEYasgS-------------- 688 Mucor circinell...
EIE77626     300 -----------------tsslLMRG----------------------------LGLSKVSEE------------------ 316 Rhizopus delema...
XP_011274216 660 -----------------adawSNVT----------------------------AN----------VGS------------ 672 Wickerhamomyces...
XP_002489432 583 ----------------------------------------------------------TNNIsklFGN------------ 592 Komagataella pa...
XP_006684607 645 ------------------ntwLWSF----------------------------NKKS----------------------- 655 Candida tenuis ...
CCE78969     641 ------------------skwLSNSe--------------------------mYT------------------------- 651 Pichia farinosa...
Q8IAY0       394 ykenvaekknahynsihnindnnicdnicdnicenicdnicdnirdnirdnmrdnirdnicdhhlndisyndedsqdtyf 473 Plasmodium falc...
Q6BJ29           -------------------------------------------------------------------------------- Debaryomyces ha...
EXX68536     698 yssp---------------------------------------------------------------------------- 701 Rhizophagus irr...
ESA19348     650 tqsrn--------------------------------------------------------------------------- 654 Rhizophagus irr...
EPB83576         -------------------------------------------------------------------------------- Mucor circinell...
EIE77626         -------------------------------------------------------------------------------- Rhizopus delema...
XP_011274216     -------------------------------------------------------------------------------- Wickerhamomyces...
XP_002489432     -------------------------------------------------------------------------------- Komagataella pa...
XP_006684607     -------------------------------------------------------------------------------- Candida tenuis ...
CCE78969         -------------------------------------------------------------------------------- Pichia farinosa...
Q8IAY0       474 ghekykrkydhndeqkkegtyyskeenssyidstksICASQDSNSEYSFFDHELSdnsnnlyeen---rrnyddhnkkRE 550 Plasmodium falc...
Q6BJ29       681 -----------------------------------vKSIEE--TASEENALDDILfslaksdkrdd-nkrkprktemnDE 722 Debaryomyces ha...
EXX68536     702 ---------------------------glleksdksENIEDPNGAVRI-------------------------------- 722 Rhizophagus irr...
ESA19348     655 -------------------------iivnspinkssSSFEDLNGADKI-------------------------------- 677 Rhizophagus irr...
EPB83576     689 ------------------------------------AELQEWQSQTDPNIMATRAn----------------------AK 710 Mucor circinell...
EIE77626     317 ------------------------------------KQVAELKQRSQSNPEIMAYka--------------------eVK 340 Rhizopus delema...
XP_011274216 673 ------------------------------------KHVEKMLKTASESATPDILkdddhnlk--------lkkikltDE 708 Wickerhamomyces...
XP_002489432 593 ------------------------------------KSIGELLLLDSKKPETENLssdspeesykksssskstrvdisAE 636 Komagataella pa...
XP_006684607 656 -------------------------------------------KAFDQNSLGDFMngivdsnpvet-pddaeskkklsQK 691 Candida tenuis ...
CCE78969     652 ------------------------------------KSTSDKGNASEENPITDIIssvfssgkkde--vnnskkvalsKD 693 Pichia farinosa...
Q8IAY0       551 SICNSNNINDALniRYDYQLQEFIMEHyiYPLAVAKSHFNYFIIKDISFFILKELI 606 Plasmodium falciparum 3D7
Q6BJ29       723 DLATLTEINKNG--RVDYSLPMGVFDF--SLVSAISAHISYFEDKDTAGFIMKQLL 774 Debaryomyces hansenii
EXX68536     723 -----KSLNSSG--RVDWVLQEGILDV--SYINAITVHLSYWSDCDAVNFIVKEIY 769 Rhizophagus irregularis DAOM 197198w
ESA19348     678 -----KTLNSTG--RIDYCLQEGILDV--SYITAIFAQLNYWSDSDISYFILKEIY 724 Rhizophagus irregularis DAOM 181602
EPB83576     711 SATKLKYLNPTG--RLDFYLQEGLLEN--AYLSALSVHMSYWQDVDVAGFLIREIY 762 Mucor circinelloides f. circinelloides ...
EIE77626     341 SAAKLGMLNPTG--RIDFCLQEGLLEN--AYISALSVHMSYWQDVDVAGFLIREIY 392 Rhizopus delemar RA 99-880
XP_011274216 709 QLSKLSSLNYNG--RVDYELKQGYFDV--SIISSISAHISYFEDENVAGFILKEIL 760 Wickerhamomyces ciferrii
XP_002489432 637 SLKVIKQLNYSG--RVDYCLSEGLFDI--SIINAIKAHTTYFENKDLTAFVLRELL 688 Komagataella pastoris GS115
XP_006684607 692 DLGELLKFNKEG--RVDFSLPRGMFDI--SLLSAISAHVSYFEDKDTAGFIMGELL 743 Candida tenuis ATCC 10573
CCE78969     694 DLGLLASANKDG--RVDYSLPMGVFDF--SLISAISAHISYFEDENTAGFLLRKVL 745 Pichia farinosa CBS 7064
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap