1JEH,1ZY8


Conserved Protein Domain Family
Pyr_redox_dim

?
pfam02852: Pyr_redox_dim 
Click on image for an interactive view with Cn3D
Pyridine nucleotide-disulphide oxidoreductase, dimerization domain
This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases.
Statistics
?
PSSM-Id: 335126
View PSSM: pfam02852
Aligned: 85 rows
Threshold Bit Score: 67.5799
Threshold Setting Gi: 81551510
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JEH_A      359 IPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQd--TEGFVKIlIDSKTERILGAHIIG-PNAGE--M 433
gi 74511917 325 VFSTFVGDVALGAAGLTEEMAKKEG--FEVVAGYGESLNRHLASIpgaAKTKVKLiFAKESGVILGGQVTGrYEVGE--M 400
gi 60416419 326 SAVSKIGDLEIGGTGLTAFSANLKRIPIVIGRAKA--LTRARYYPg-gKEIEIKMiFNE-DGKVVGCQIVGgERVAE--R 399
gi 74514412 319 SQLTGFKDIEIGKAGLSENEAIRFG--YEVVSAFITSRTSARYLPg--GLIHLKVvADR-NGKLLGLQAVG-KDVAM--R 390
gi 74514193 319 TQLTKFFDLEIGATGLTEKAAKAEG--FEVKTAVVKAKTRVHYYPg-aKDTFLKVvADASTKRILGAQVLG-ADVAM--R 392
gi 81556479 341 TAVSKVCDLEIARTGLREKDALRAG--LRFVTATVESTSRAGYYPn-aSPMTVKMlAERRTGRLLGVQIVG-R-EGAgkR 415
gi 81551510 326 TSIFKVFGLGVARTGLTQGEAAALG--LNAVSVDVTSTDHAGYYAd-aRPIHVRLtGERGTGRLLGGQLVA-ENPLSvkR 401
gi 74514185 332 TAIFKVFDFTAASAGVNEQMAKEAG--LDYFTVIAPSPDRAHYYPq-aNYIRLKLiVEKGSWRVIGAQGVG-M-GEVakR 406
gi 81342986 327 SASIKILSLEAARTGLTEKDAKKLQ--IKYKTIFVKDKNHTNYYPg-qEDLYIKLiYEENTKIILGAQAIG-KNGAVi-R 401
gi 30179815 326 SSGLAVFDYKFASTGINEVMAQKLG--KETKAVTVVEDYLMDFNPd-kQKAWFKLvYDPETTQILGAQLMS-K-ADLtaN 400
                        90       100       110
                ....*....|....*....|....*....|....*
1JEH_A      434 IAEAGLALEYGASAE-DVARVCHAHPTLSEAFKEA 467
gi 74511917 401 VNQIAMAIQNNLTASeIDTLQIGTHPLLTSAPTTP 435
gi 60416419 400 IDAMSIAIFKKVSAEeLANMEFCYAPPVS--MVHE 432
gi 74514412 391 VYAASALLHKNGDVKdLFFCDFPYYPPVS--RVWD 423
gi 74514193 393 VNVFAAMIQGGFTTKdVFFADLGYAPPFT--PIWD 425
gi 81556479 416 VDIAAVALTAGMTVEqMTALDLGYAPPFS--PVWD 448
gi 81551510 402 VDVIAAHLHSRGKVEdLFQMDLAYAPPFS--GVWD 434
gi 74514185 407 IDVLSTAIQAGMTIDqLANLDLAYAPPYSPALDPV 441
gi 81342986 402 IHALSIAIYSKLTTKeLGMMDFSYSPPFS--RTWD 434
gi 30179815 401 INAISLAIQAKMTIEdLAYADFFFQPAFD--KPWN 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap