3HJA,1HDG,2EP7,3K2B,2X5K,2YYY,1CF2


Conserved Protein Domain Family
Gp_dh_C

?
pfam02800: Gp_dh_C 
Click on image for an interactive view with Cn3D
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.
Statistics
?
PSSM-Id: 308445
View PSSM: pfam02800
Aligned: 50 rows
Threshold Bit Score: 140.423
Threshold Setting Gi: 3122123
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3HJA_D       179 LAPLAKVLHESFGIEQGLMTTVHAYTNDQRILD-LPHSDLRRARAAA--LSIIPTSTGAAKAVGLVLPELKGKLNGTSMR 255 Borrelia burgdo...
P0C6C2       164 IVPIIKVLDDAFGIDSGTITTIHSSMNDQQVIDaYHN-DLRRTRAAS--QSIIPVDTKLHKGIERIFPKFSNKFEAISVR 240 Vibrio cholerae...
2X5K_O       160 IIPVIKLLDDAYGIESGTVTTIHSAMHDQQVIDaYH-PDLRRTRAAS--QSIIPVDTKLAAGITRFFPQFNDRFEAIAVR 236 Escherichia col...
2YYY_A       149 LCRILYAINSIADIKKARIVLVRRAADP---------NDDKTGPVNAitPNPVTVPSHHGPDVVSVVPEFEGKILTSAVI 219 Methanocaldococ...
P61879       146 LVRTLNAIKDYVDY--VYAVMIRRAADP---------NDIKRGPINAi-KPSVTIPSHHGPDVQTVIP---INIETSAFV 210 Pyrococcus furi...
O27090       145 LCRTLKPIDDLCGIKKVRAVMVRRGADP---------VQVKKGPINAivPNPPTVPSHHGPDLKTVMK--GVNIHTVALL 213 Methanothermoba...
P55971       156 IAPICAILDKAFKIKEGMLTTIHSYTSDQKLIDlAHPLDKRRSRAAA--SNIIPTTTKAALALHKVLPNLKNKMHGHSVR 233 Helicobacter py...
O25902       154 SAPLLKILDEAFKVENALLTTIHSYTNDQNLLDtKH-KDIRRARAAG--LNLIPTSTGVSKAISLVLPHLGPKVTGLAIR 230 Helicobacter py...
1CF2_P       145 LCRTLKPLHDSFGIKKVRAVIVRRGADP---------AQVSKGPINAiiPNPPKLPSHHGPDVKTVLD---INIDTMAVI 212 Methanothermus ...
WP_007819802 294 IVPPLKAMADEFGVESGHVETVHSFTNDQNLLDnYH-KSDRRGRSAP--LNMVLTETGAASAVAKALPDLEAKISGSSIR 370 Streptomyces sp...
3HJA_D       256 VPVPTGSIVDLTVQLKKKdVTKEEINSVLRKASEt---PELKGILGYTEDPIVSSDIKGNSH--SSIVDGLETMVLengf 330 Borrelia burgdo...
P0C6C2       241 VPTVNVTAMDLSVTIKSN-VKVNDVNQTIVNASQ----CTLRGIVDYTEAPLVSIDFNHDPH--SAIVDGTQTRVSngql 313 Vibrio cholerae...
2X5K_O       237 VPTINVTAIDLSVTVKKP-VKANEVNLLLQKAAQ----GAFHGIVDYTELPLVSVDFNHDPH--SAIVDGTQTRVSgahl 309 Escherichia col...
2YYY_A       220 VPTTLMHMHTLMVEVDGD-VSRDDILEAIKKTPRiitvRAEDGFSSTAKIIEYGRDLGRLRYdiNELVVWEESINVlene 298 Methanocaldococ...
P61879       211 VPTTIMHVHSIMVELKKP-LTREDVIDIFENTTRvllfEKEKGFESTAQLIEFARDLHREWNnlYEIAVWKESINVkgnr 289 Pyrococcus furi...
O27090       214 VPTTLMHQHNIMVELEDP-VEADEIKARLDETTRvmlvRASEGLASTAEIMEYAKELGRSRNdlFEIPVWEESINVvdge 292 Methanothermoba...
P55971       234 VPSLDVSMIDLSLFLEKK-APKDPINDLLIEASK----GVLKGVLEIDLKERVSSDFISNPH--SVIIAPDLTFTLen-m 305 Helicobacter py...
O25902       231 VPTPNVSLVDLSLNFKKS-VSKASVQHALKDACK----HAFKGVVSIDEERLVSSDFISSPF--SAIVIDDQIMTIgekn 303 Helicobacter py...
1CF2_P       213 VPTTLMHQHNVMVEVEET-PTVDDIIDVFEDTPRviliSAEDGLTSTAEIMEYAKELGRSRNdlFEIPVWRESITVvdne 291 Methanothermus ...
WP_007819802 371 VPVPDVSIAILNLRLSRG-TSREEVLTHLREVSLt--sPLRRQIDFTTSADAVSSDFVGSRH--ASIVDAGATKVDgd-n 444 Streptomyces sp...
3HJA_D       331 aKILSWY 337 Borrelia burgdorferi B31
P0C6C2       314 vKMLVWC 320 Vibrio cholerae O1 biovar El Tor str. N16961
2X5K_O       310 iKTLVWC 316 Escherichia coli K-12
2YYY_A       299 iFLMQAV 305 Methanocaldococcus jannaschii DSM 2661
P61879       290 lFYIQAV 296 Pyrococcus furiosus DSM 3638
O27090       293 lFYMQAV 299 Methanothermobacter thermautotrophicus str. Delta H
P55971       306 vKIMGWY 312 Helicobacter pylori 26695
O25902       304 aKVLAWY 310 Helicobacter pylori
1CF2_P       292 iYYMQAV 298 Methanothermus fervidus
WP_007819802 445 aILYLWY 451 Streptomyces sp. Tu6071
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap