Conserved Protein Domain Family
Chal_sti_synt_C

?
pfam02797: Chal_sti_synt_C 
Chalcone and stilbene synthases, C-terminal domain
This domain of chalcone synthase is reported to be structurally similar to domains in thiolase and beta-ketoacyl synthase. The differences in activity are accounted for by differences in the N-terminal domain.
Statistics
?
PSSM-Id: 308442
View PSSM: pfam02797
Aligned: 6 rows
Threshold Bit Score: 232.737
Threshold Setting Gi: 75277399
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7X795       244 ELQFSTQEFLPGTDKVIDGKITEEGINFKLGRDLPEKIENRIEGFCRTLMDRVGIK--EFNDVFWAVHPGGPAILNRLEV 321 Japanese rice
O81305       238 ELHCAMQQFLPQTQGVIDGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKAGSGalELNDLFWAVHPGGPAILSGLET 317 thale cress
O23674       245 ELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDEsmEFNDMFWAVHPGGPAILNRLET 324 thale cress
CBI31794     102 QLVSAAQTFIPNSAGAIAGNLREVGLTFHLWPNVPTLISENIEKCLTKAFDPLGIS--DWNSLFWIAHPGGPAILDAVEA 179 wine grape
Q96562       240 QLVSASQTILPESEGAIDGHLTEAGLTIHLLKDVPGLISENIEQALEDAFEPLGIH--NWNSIFWIAHPGGPAILDRVED 317 Hordeum vulgare
XP_006355706 241 EIVSAAQTFVPNGDCHLALHLREMGLTFHCTRDVPPTIAKNVESCLIKAFEPLGIS--DWNSVFWILHPGGNAIVDQVES 318 potato
Q7X795       322 CLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLRD-ELKKGMIRE----EWGLILAFGPGITFEGMLVR 386 Japanese rice
O81305       318 KLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRD-ELEKKGTEGe---EWGLGLAFGPGITFEGFLMR 383 thale cress
O23674       325 KLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRD-ELKKKGDAAq---EWGLGLAFGPGITFEGLLIR 390 thale cress
CBI31794     180 KLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKkSLKGEKATTgeglDWGVLFGFGPGLTIETVVLH 249 wine grape
Q96562       318 RVGLDKKRMRASREVLSEYGNMSSASVLFVLDVMRKsSAKDGLATTgegkDWGVLFGFGPGLTVETLVLH 387 Hordeum vulgare
XP_006355706 319 TLGLEPDKLRATRNILREYGNLSSACVLFILDEIRKkSARYGLKTTgdglDLGVLLSFGPGLTIETVVLR 388 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap