3MOG,2WTB,4OM8


Conserved Protein Domain Family
3HCDH_N

?
pfam02737: 3HCDH_N 
Click on image for an interactive view with Cn3D
3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
This family also includes lambda crystallin.
Statistics
?
PSSM-Id: 367161
View PSSM: pfam02737
Aligned: 63 rows
Threshold Bit Score: 150.769
Threshold Setting Gi: 81465232
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MOG_A            7 TVAVIGS-GTMGAGIAEVAASH-GHQVLLYDI--SAEALTRAIDGIHA---RLNSRVTRGKLT---AETCERTLKRLIPV 76  Escherichia ...
wugsc:CKO_00862   3 NVAVIGA-GVMGTGVAHNMAQY-GISTNVVDI--SQSQLDKCRQMIEAn-lRLYNFHPQHKKK---THSTAEIMENIRFT 74  Citrobacter ...
Q8FRN7           14 QAVVIGA-GSMGAGIATLLANA-GITVTLLDR--HSGDPEDPNRLAES---GLERQIQRGAFY---RPEFSSRIQTGNIV 83  Corynebacter...
Q5SJW2            4 KVGVVGA-GTMGSGIAALVASA-GIPVVLLDIpgKEDRNEYAKRGLER---ALKA--RPAAFM---DPERARYIEIGNTE 73  Thermus ther...
Q8EYS5            6 TVTVLGAnGTMGAGSAAIVASFgKAKVHMLAR--DTNKAKEGIEKAI------------GSVK---TDTIRPRLIPGSYD 68  Leptospira i...
Q82NF5            7 AAAVVGA-GTIGLSWAALFAGH-GIRVRITDP--RPDLAEAVAEALDQ---AAGQLAAQGL-------DVHGLAERVLIA 72  Streptomyces...
CAC37460          3 TVTVIGA-GTIGLGWINLFSAR-GLTVRVNSR--RPDVRRVVHEALEL--------FSPGRVD--------ELAARIEYE 62  Streptomyces...
Q7VX88            3 HVAVIGG-GIIGASWAIVFARR-GLEVTIVER--DAACLAGLPARLAG---MIERSASLLRAG----EQPGDVAARIGAT 71  Bordetella p...
Q7VWZ3           14 RVAVVGA-GTIGASWAALFAAR-GLRVTVTDP--APGAAESLRGRIAD---IWPALAAAGAIQdgaDPDA------VRFD 80  Bordetella p...
O29062            4 KVACIGA-GTVGASWASLFAWR-GCDVAVYDP--FPEALNRAEASIARtvsTLSEIfs------gsEDDVKSALSRVKFT 73  Archaeoglobu...
3MOG_A           77 TDIHALA-AADLVIEAASERLEVKKALFAQLAEVCPPQTLLTTNTSSISITAIAAEIK-NPER--VAGLHFFNPAPVMKL 152 Escherichia ...
wugsc:CKO_00862  75 TELDDIV-ECDLVIENITEDIEKKNALYTRMNTICGASTVFGVNTSAISITALSKLMR-HPEN--VVGVHFMNPVPLMHT 150 Citrobacter ...
Q8FRN7           84 DDTAALT-RADWIIEAVFEDLTVKHDTFRLIEEHRSPGSLVSSNTSTIPLAQLTEVMG-TPMRldFAIVHFFNPPTTMRL 161 Corynebacter...
Q5SJW2           74 DHLEKLR-DCDWVVEAIVEKPEPKQALYARLENLLKPTAIVSSNTSGIPMRVLLEGRS-EGFRrrFLGTHFFNPPRYLHL 151 Thermus ther...
Q8EYS5           69 ADLEKAVsESDWVFELVAESYEVKEPINKRIASSRRPGTIVSTVSSGLSIERLSKAFD-EDGQkhYFGTHFFNPPYKMIL 147 Leptospira i...
Q82NF5           73 DDLADAVrDADVVQENGPENAAFKRELFTDLVGTAPAHALLLSSSSAIPATAFTDTIE-DAGR--ILIGHPFNPPHLVPL 149 Streptomyces...
CAC37460         63 PDVGRAVaGADVVSENAPDDLPLKQRLFAEIGAAAPDHALVLSSTSKLLPDELSRDMP-GPGR--LVVAHPFNPPHIVPL 139 Streptomyces...
Q7VX88           72 DALAAAVgRADYVQEAVSENLAFKRTLFAELDALAPGHALLASSTSTYGASQFTEALA-GRAR--CLVAHPMTPPHLSPV 148 Bordetella p...
Q7VWZ3           81 ADLQEALrDADFVQENAPERPDFKADLFTRMDAALPPHTIIASSSSGLPMSALQAGCR-HPER--CVIGHPFNPPHLIPL 157 Bordetella p...
O29062           74 ENLEEALkGAYYVQESAVEKLEVKRDLFEKMDAIAEPETILATSTSGLSISEIQTAARkHPER--CITAHPYNPPHLIPL 151 Archaeoglobu...
3MOG_A          153 VEVVSGLATAAEVVEQLCELTLSW-GKQPVRC 183 Escherichia coli K-12
wugsc:CKO_00862 151 VELIRGVHTAERTLNIFHHLFAQL-NKTGIVV 181 Citrobacter koseri ATCC BAA-895
Q8FRN7          162 VELVTGPDTTPKTATDLTRIIEQQlGKVVLHC 193 Corynebacterium efficiens
Q5SJW2          152 LELIPTPETDPKVLEEIRRFGERIlGKGTVLA 183 Thermus thermophilus HB8
Q8EYS5          148 CELVSHKGSDKKVLKQLGEYLEKVlGRAVVYT 179 Leptospira interrogans
Q82NF5          150 VEVVPGERTSEESVARAVEFYRFV-GRVPVVE 180 Streptomyces avermitilis
CAC37460        140 VEVVRGERTDPEAVERTLAFLASV-GRTPVVV 170 Streptomyces coelicolor A3(2)
Q7VX88          149 VEMAASAWTDPQALAGAETFMRSL-GQHPVRI 179 Bordetella pertussis
Q7VWZ3          158 VEVVAGRQTAPAAIERAMAFYRSL-GKYPIRI 188 Bordetella pertussis
O29062          152 VEVVPRKQTDESCTEKTVEFMERM-GKKPIVV 182 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap