4FAK,5TWJ,1O6D


Conserved Protein Domain Family
SPOUT_MTase

?
pfam02590: SPOUT_MTase 
Click on image for an interactive view with Cn3D
Predicted SPOUT methyltransferase
This family of proteins are predicted to be SPOUT methyltransferases.
Statistics
?
Aligned: 704 rows
Threshold Bit Score: 119.796
Threshold Setting Gi: 229564361
Created: 27-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FAK_A           5 MKITILAVGKLKEKYWKQAIAEYEKRLGPy------TKIDIIEVpdekapenMS--DKEIEQVKEKE--GQRILakikPQ 74  Staphylococcu...
CCB63345         1 MRIAISAVGKLKDAEERAIVERYAKRLNGagkplglGPIDIREYpesraa--------dvaerKRDE--AARLLrdvgPG 70  Hyphomicrobiu...
Q5FRS9           1 --mKLVAIGRLKAGPERELFERYAGRIRP--------ALTVTELaps---kgSV------QEQKRQD--AAALLgacpDN 59  Gluconobacter...
A9HC19           1 --mRLIAVGRMKDRVERDLFQRYAERLSP--------RLDLVEVaeg---rgAP------AEIKRRE--GQALLsalpDR 59  Gluconacetoba...
EFG85733         1 ----mIAIGRMKDRVEKDLFNRYADRLSP--------RLKLTELpeg---rgAA------GEAKRRE--GQALLaalpPR 57  Komagataeibac...
BAH98528         1 --mRLVAIGRMKDKSERALVERYLKRLRP--------KLEIIELpdg---rgSP------DEIKRRE--AQAILaacpAQ 59  Acetobacter p...
Q0BRE3           3 apwRIIAVGRMRGSEEEALFQRYAARLRP--------ALTVTEIaea---rgST------AEIRRRE--TSALLaalpPA 63  Granulibacter...
A5FYS5           6 aRLRIIAIGRDSKGPEADLVARYAARLQP--------RPEVVALpdg---tgSP------AEIKRRE--ADAILrrlaAE 66  Acidiphilium ...
Q1IVS1           1 MKLRVVWIGKTKESAIQTLTGEYLKRLSRy------VATEGLEIgsee----------allKLKDRP--Gr-------TA 55  Candidatus Ko...
jgi:Terro_0173   5 VSLLAVRAG-AADKAVESLAQDYLKRCGRtlpa---------------aartFRteAGLLENVADERksGATLF------ 62  Terriglobus r...
4FAK_A          75 STVITLEIQGKMLSSEGLAQELNQRMTQGQsDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFK 154 Staphylococcu...
CCB63345        71 DIAVALEPIGKSLTSEAFAAFLRETRDGGAkSCVYLIGGPDGHGEAVLSAATLKLSLGALTLPHGLARVVLAEQLYRAAT 150 Hyphomicrobiu...
Q5FRS9          60 ALIVALDEGGKTPDSLRLAEMLSRWQESGR-PIHFLIGGAEGLDSSVIQRADSVISLGKLTWPHMLVRVLIAEQVFRAQA 138 Gluconobacter...
A9HC19          60 AFAVALDEGGRAHDSLAFARVLERWLGLSR-PVCFLVGGAEGLDGPVLARADDTLSLGPMTWPHMLIRGLLAEQLYRARA 138 Gluconacetoba...
EFG85733        58 AQVVAMDEGGRTYDSLSFARALERWMGLSR-PICFLIGGAEGLDGCVIERADETLSLGQMTWPHMLVRGLLAEQLYRARA 136 Komagataeibac...
BAH98528        60 SHVVVLDEAGRNFSSPEFSNAVQGWLTAGR-TPCFVIGGAEGLDASVIQRADASMSFGTLTWPHMLVRIMLVEQIYRAQA 138 Acetobacter p...
Q0BRE3          64 CIVVAMDLGGRAHDSEALATLARRWREQPL-PVCFMIGGAEGLEQPVLDRADHVLSLGPMTWPHLLVRPLLAEQLYRAQA 142 Granulibacter...
A5FYS5          67 DLVIALDLGGKAPDSAAFAAMLASWRETSR-PLAFVIGGAEGLERRIIERADAVLSLGNLTLPHLLARAVLAEQLYRAQC 145 Acidiphilium ...
Q1IVS1          56 PVLVLMDERGKQVGSEELANFLGYHRDQGVqDLIFAIGPSDGWQKETLKSATQVLSMGKMTLPHELARVVLLEQLYRGYT 135 Candidatus Ko...
jgi:Terro_0173  63 ---FIADLGGASLDSLQFADKLRSARDNGVrHVVLAIGPASGWSAEARAAADLRLSLGAMTLPHELAWLILAEQIYRAST 139 Terriglobus r...
4FAK_A         155 IMRGEAYH 162 Staphylococcus aureus
CCB63345       151 ILAGHPYH 158 Hyphomicrobium sp. MC1
Q5FRS9         139 INTGHPYH 146 Gluconobacter oxydans 621H
A9HC19         139 IASGHPYH 146 Gluconacetobacter diazotrophicus PA1 5
EFG85733       137 IATGHPYH 144 Komagataeibacter hansenii ATCC 23769
BAH98528       139 IAAGHPYH 146 Acetobacter pasteurianus IFO 3283-01
Q0BRE3         143 IATNHPYH 150 Granulibacter bethesdensis CGDNIH1
A5FYS5         146 ILAGHPYH 153 Acidiphilium cryptum JF-5
Q1IVS1         136 ILTGHPYH 143 Candidatus Koribacter versatilis Ellin345
jgi:Terro_0173 140 ILQGHPYH 147 Terriglobus roseus DSM 18391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap