1W3S


Conserved Protein Domain Family
RecO_C

?
pfam02565: RecO_C 
Click on image for an interactive view with Cn3D
Recombination protein O C terminal
Recombination protein O (RecO) is involved in DNA repair and pfam00470 pathway recombination.
Statistics
?
PSSM-Id: 308267
View PSSM: pfam02565
Aligned: 102 rows
Threshold Bit Score: 60.4855
Threshold Setting Gi: 81597331
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W3S_B        83 LAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQP-DPEWVALV-MSYKLLGLAGVIPQTARCARCGAPD 160
gi 238692226  84 EPSMERFSAIYRLIEILKISTGNEEKNIRLFNALERTLEKLCAPC-RNADAAVAwFMLKLISESGFEPSIEQCVTTGKSI 162
gi 229485532  84 QPDIERYAIMYRIIDLVSQSIDGQEKNIPLFSLIASVLEELYSTS-DRFRLLYSwFLLKLVSLLGFEPSIHRCVLSHEEI 162
gi 123354271  85 PFDIHKTSISIFLSELLLKTLKEESDNQELFDFLFHSLHALDKIEkNVLNFHVS-FMLRYSFYLGFFPQETKSVWEN--- 160
gi 81317086   85 PYDPFKSAIALFLAEFLYRAIREEAENRPLFAYLQHSILWLDTCKiSFANFHLV-FLMRLSRFLGLYPNLDDYHAGDYFD 163
gi 81572004   87 QSDPVRNSIALFLAEFLYLILRLPEADTNLYDFVAFSIDKLEEMDgPMANFHLA-FLFRLLVPLGLIPDLQFGGSVIPRW 165
gi 506233766  86 HSDIRKGAIALFLSEVLSESIREEETNPELFSYLEHTLQWLDQHQ-RIANFHIR-FLMGLTRYLGFYPDQTDSHA----- 158
gi 503071125  86 HSDISKNAITLFLSEMLANSIQEEERNEGLFYYMESALQWLDANT-EANNFHIY-FLIDLTKYLGFYPDTTSTEGLYFDL 163
gi 505294737  87 YSNIVKQSVVLFLSEVLSNAIQEEEQNTTLYEYLETALQWLDLHD-NVANFHLL-FLLNLTGFLGFYPDLSDHTKNGFDL 164
gi 495478721  85 PFDFNRTGLALFMTEIVSRSIFENYQNEHLFDFLSMSILVLDQKDtSLKHFPLV-FLMEQAKYLGFAPDSASGFLMENR- 162
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W3S_B       161 PEHPDPLG---------------GQLLCSKCAALPPYPPAVLDFLRHAVRR-TVRA--SFEQPVPSADRPALWRALEKFV 222
gi 238692226 163 LPMLQEGSaddlcltydpggvslPVPAAQKGPPGQRLPVQVYLLMRTLNRL-DIRS--IDEIDIPADNSRLLCDILQNYC 239
gi 229485532 163 SPATLAENkgelcflfnpggvalPASKSVIENENRPLSMATYALLSAISST-PLNL--LKNIEAIPPQTDLLCNLLEEYC 239
gi 123354271 161 -----------------------------------SLYKPSAEIITYLENCmKYTY--FESFSSTNVHRREALDIVIAFY 203
gi 81317086  164 MLNATF-------------------TSVRPQLHSSYIQPDEAGRLLQLMRM-NYET--MHLFGMNRTERARCLAIINEYY 221
gi 81572004  166 FDPADGR------------------FVPNAPAHGRGIPPHQSTYLQLFSRI-TFDN--MKAFRLSRAERRQVLDYLVDYY 224
gi 506233766 159 --PYFDLSeg-----------ayCS----KPGLNPVLADGNLEAFRNILGT-NFDA--IHTVELTQAERRELLNSLILYY 218
gi 503071125 164 LEAEF----------------------TNNLTLSPNIKGENLNYFKRFLGI-NFDT--LNKIKMKKANRQELLQSLVLYF 218
gi 505294737 165 LEGVY----------------------SDNFANKNVIHKNDFYQFKKLLGI-NFDE--IQEVSFSKEERQVVLQIIIQYF 219
gi 495478721 163 ---------------------------------GQPFSPEEYLIVKEFLEQ-LMQYsyHCDTQVTLAIRRKLIDHLLEFY 208
                        170
                 ....*....|....
1W3S_B       223 TVQVG---GVHSWR 233
gi 238692226 240 SLHNNy-nPSSKNR 252
gi 229485532 240 TLHLVh-hPHKKNI 252
gi 123354271 204 KNQIEs-fGDMHSI 216
gi 81317086  222 RLHLPd-fPILKSL 234
gi 81572004  225 RFHLPp-fPLLKTP 237
gi 506233766 219 EIHLQgfkKPRSLt 232
gi 503071125 219 ELHLQg-fRKPRSL 231
gi 505294737 220 KLHLGn-fRNPKSL 232
gi 495478721 209 SQQLEs-nATWKSM 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap