1W3S


Conserved Protein Domain Family
RecO_C

?
pfam02565: RecO_C 
Click on image for an interactive view with Cn3D
Recombination protein O C terminal
Recombination protein O (RecO) is involved in DNA repair and pfam00470 pathway recombination.
Statistics
?
PSSM-Id: 308267
View PSSM: pfam02565
Aligned: 102 rows
Threshold Bit Score: 60.4855
Threshold Setting Gi: 81597331
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W3S_B        83 LAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQP-DPEWVALV-MSYKLLGLAGVIPQTARCARCGAPD 160 Deinococcus rad...
B3EKJ8        84 EPSMERFSAIYRLIEILKISTGNEEKNIRLFNALERTLEKLCAPC-RNADAAVAwFMLKLISESGFEPSIEQCVTTGKSI 162 Chlorobium phae...
A1BJG7        84 QPDIERYAIMYRIIDLVSQSIDGQEKNIPLFSLIASVLEELYSTS-DRFRLLYSwFLLKLVSLLGFEPSIHRCVLSHEEI 162 Chlorobium phae...
Q11PX3        85 PFDIHKTSISIFLSELLLKTLKEESDNQELFDFLFHSLHALDKIEkNVLNFHVS-FMLRYSFYLGFFPQETKSVWEN--- 160 Cytophaga hutch...
Q5LIK3        85 PYDPFKSAIALFLAEFLYRAIREEAENRPLFAYLQHSILWLDTCKiSFANFHLV-FLMRLSRFLGLYPNLDDYHAGDYFD 163 Bacteroides fra...
Q7MTF5        87 QSDPVRNSIALFLAEFLYLILRLPEADTNLYDFVAFSIDKLEEMDgPMANFHLA-FLFRLLVPLGLIPDLQFGGSVIPRW 165 Porphyromonas g...
WP_015753541  86 HSDIRKGAIALFLSEVLSESIREEETNPELFSYLEHTLQWLDQHQ-RIANFHIR-FLMGLTRYLGFYPDQTDSHA----- 158 Robiginitalea b...
WP_013306082  86 HSDISKNAITLFLSEMLANSIQEEERNEGLFYYMESALQWLDANT-EANNFHIY-FLIDLTKYLGFYPDTTSTEGLYFDL 163 Maribacter sp. ...
WP_015481839  87 YSNIVKQSVVLFLSEVLSNAIQEEEQNTTLYEYLETALQWLDLHD-NVANFHLL-FLLNLTGFLGFYPDLSDHTKNGFDL 164 Polaribacter sp...
WP_008203408  85 PFDFNRTGLALFMTEIVSRSIFENYQNEHLFDFLSMSILVLDQKDtSLKHFPLV-FLMEQAKYLGFAPDSASGFLMENR- 162 Algoriphagus sp...
1W3S_B       161 PEHPDPLG---------------GQLLCSKCAALPPYPPAVLDFLRHAVRR-TVRA--SFEQPVPSADRPALWRALEKFV 222 Deinococcus rad...
B3EKJ8       163 LPMLQEGSaddlcltydpggvslPVPAAQKGPPGQRLPVQVYLLMRTLNRL-DIRS--IDEIDIPADNSRLLCDILQNYC 239 Chlorobium phae...
A1BJG7       163 SPATLAENkgelcflfnpggvalPASKSVIENENRPLSMATYALLSAISST-PLNL--LKNIEAIPPQTDLLCNLLEEYC 239 Chlorobium phae...
Q11PX3       161 -----------------------------------SLYKPSAEIITYLENCmKYTY--FESFSSTNVHRREALDIVIAFY 203 Cytophaga hutch...
Q5LIK3       164 MLNATF-------------------TSVRPQLHSSYIQPDEAGRLLQLMRM-NYET--MHLFGMNRTERARCLAIINEYY 221 Bacteroides fra...
Q7MTF5       166 FDPADGR------------------FVPNAPAHGRGIPPHQSTYLQLFSRI-TFDN--MKAFRLSRAERRQVLDYLVDYY 224 Porphyromonas g...
WP_015753541 159 --PYFDLSeg-----------ayCS----KPGLNPVLADGNLEAFRNILGT-NFDA--IHTVELTQAERRELLNSLILYY 218 Robiginitalea b...
WP_013306082 164 LEAEF----------------------TNNLTLSPNIKGENLNYFKRFLGI-NFDT--LNKIKMKKANRQELLQSLVLYF 218 Maribacter sp. ...
WP_015481839 165 LEGVY----------------------SDNFANKNVIHKNDFYQFKKLLGI-NFDE--IQEVSFSKEERQVVLQIIIQYF 219 Polaribacter sp...
WP_008203408 163 ---------------------------------GQPFSPEEYLIVKEFLEQ-LMQYsyHCDTQVTLAIRRKLIDHLLEFY 208 Algoriphagus sp...
1W3S_B       223 TVQVG---GVHSWR 233 Deinococcus radiodurans R1
B3EKJ8       240 SLHNNy-nPSSKNR 252 Chlorobium phaeobacteroides BS1
A1BJG7       240 TLHLVh-hPHKKNI 252 Chlorobium phaeobacteroides DSM 266
Q11PX3       204 KNQIEs-fGDMHSI 216 Cytophaga hutchinsonii ATCC 33406
Q5LIK3       222 RLHLPd-fPILKSL 234 Bacteroides fragilis NCTC 9343
Q7MTF5       225 RFHLPp-fPLLKTP 237 Porphyromonas gingivalis W83
WP_015753541 219 EIHLQgfkKPRSLt 232 Robiginitalea biformata
WP_013306082 219 ELHLQg-fRKPRSL 231 Maribacter sp. HTCC2170
WP_015481839 220 KLHLGn-fRNPKSL 232 Polaribacter sp. MED152
WP_008203408 209 SQQLEs-nATWKSM 221 Algoriphagus sp. PR1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap