Conserved Protein Domain Family
DUF148

?
pfam02520: DUF148 
Domain of unknown function DUF148
This domain has no known function nor do any of the proteins that possess it. In one member of this family the aligned region is repeated twice.
Statistics
?
Aligned: 76 rows
Threshold Bit Score: 51.0405
Threshold Setting Gi: 0
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAP29912      104 VVKIL-SDTTLTVEQVIEKLTKLLKGK--LDENLIAKLLASVAELVEKLLDGIAKILGNLGNVFEDIKKILDNKNQKIED 180  Caenorhabditi...
6_pfamImport    6 FLALAgQVTNMTISDYETAVNAWAAKY--QLTAEVEAFNERAVNASVSAEEHANTVVMSLPNVLTNIKAIGSDKNQTLAQ 83  
CAP26207      170 FYAILpKVGNMTINEFETAVDEWAAKY--GLTQEVEAFNQRKENETAAAEAHANDVVMNLPNVINNLKAIRADKNQTAME 247  Caenorhabditi...
9_pfamImport    6 FSGIF-HDRDLAKGEKNQQMRDWAEKY--SMQEEMNEFLASKKADRERQKQERRENYERVGELLDKVDDILDNEKNTWQD 82  
PDM72711       76 FFRII-FDRNLTKGEIKKKVGEWAVKN--HIEAQVKAYHEKIVAYFTQHHKNVTAAIGKLQKAYESLTSIIKDDSLTRHQ 152  Pristionchus ...
PDM78533      289 YFDIV-FDRNSTKAEIKKSVAAWAKKS--GVEKQVMAEHEKREKFFAEHNKNITEAISKLADAQTSILAVLKDDSLTGPQ 365  Pristionchus ...
PDM83212     1632 YYKII-FARNSTRGEIKKNLVEWSKKN--GVEKQLVAHNEKREFFFSEHNKNVTEAIPKLAAAQTSVLSILKDESLTRKQ 1708 Pristionchus ...
PDM74750       95 FFQIF-ENANQTKAQTKERIHDWASKQpqSVQDGVIAFERNLTVAREAMRENATAVILQLETALDRFSTVLEDENLTQRE 173  Pristionchus ...
PDM80166       62 FMQIL-AEANLTKGEMKERVHEWAERQpdNVKESVHKFERDITVAHTAMQKNAIAVIRQLEMVFVMLSSILDDLSLTRGE 140  Pristionchus ...
PDM79690       73 YFKLI-EIKNQTKGEIKSAVDAWANTY--NVSAAVTAFESEMETLKTERRANVTTAVGELAEAIYALNAIQDDQNISNAE 149  Pristionchus ...
CAP29912      181 QKEAINKLKKQFPIE-VDTIFHIAAQ 205  Caenorhabditis briggsae
6_pfamImport   84 MHATIIEYIDSLHAD-VKEIVVV--- 105 
CAP26207      248 MHSRMMTYINSLDDD-TQEIVFVFFk 272  Caenorhabditis briggsae
9_pfamImport   83 AKTQLLALVEEENREvTNAFKAFYP- 107 
PDM72711      153 TYVKIHDLFISYPRE-LRSLLYATRP 177  Pristionchus pacificus
PDM78533      366 TWDKIREQTKNYSPQ-LRALLWAMKP 390  Pristionchus pacificus
PDM83212     1709 SWEKINELTKNYSPQ-LKALVWAMKP 1733 Pristionchus pacificus
PDM74750      174 TMEKLRNTARSFDRDiVFAVKMIMRN 199  Pristionchus pacificus
PDM80166      141 MEEELRRTAGTFDVDavsavrglsvn 166  Pristionchus pacificus
PDM79690      150 TSAQIREAIQAMSPE-LRDLVLAAmp 174  Pristionchus pacificus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap