2ZZN,3A27


Conserved Protein Domain Family
Met_10

?
pfam02475: Met_10 
Click on image for an interactive view with Cn3D
Met-10+ like-protein
The methionine-10 mutant allele of N. crassa codes for a protein of unknown function. However, homologous proteins have been found in yeast, suggesting this protein may be involved in methionine biosynthesis, transport and/or utilisation.
Statistics
?
PSSM-Id: 280612
View PSSM: pfam02475
Aligned: 9 rows
Threshold Bit Score: 246.495
Threshold Setting Gi: 731672
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZZN_B  95 LSYDVVGDLVILQISDEVDEkIRKEIGELAYKLI-PCKGVFRRKSEV--KGEFRVRELEHLAG-ENrTLTIHKENGYRLW 170
O29554  21 RSFEIIGDVVIIEIPDEIMH-HSRDIVEAILKRHkHVKTVLRKVGEV--DGVYRVARYEPIYG-EK-TETVVREHGCRFL 95  Archaeoglobus fulgidus
P38793 176 TGFTITGHIAHLNLRTEFKP-FDSLIGQVILDKNnKIECVVDKVSSI--ATQFRTFPMKVIAGkSDsLVVEQKESNCTFK 252 Saccharomyces cerevis...
O28306  90 TNYKVIGDIVVVKLDERARE-YAKVIGEALMQIN-PCKAVWCDYGR---YGMKRKPRMELIAG-EG-SVTEHRENGCRFR 162 Archaeoglobus fulgidus
O27268   4 MKWARIGDIIVLNREADDPE--------ALLEME-GVRSVIRVEGI---HGPLRRPRVRVLAG-SG-TETVHKENGCLFR 69  Methanothermobacter t...
3A27_A  26 IKYQKIGDVVIVKKELSEDE-IREIVKRT------KCKAILLYTTQI--TGEFRTPHVKILYG-KE-TETIHKEYGCLFK 94  Methanocaldococcus ja...
Q8U3G7  28 kRWVKIGDVLLLPLRPELEP-YKYKIAKAYAEVL-EVKTVLRKGHI---YGETRKPDYEILYG-SD-TITIHVENGIKYK 100 Pyrococcus furiosus
O27901  88 RSFDIIGDTVILEIPEELQD-YRFIIGEAALEFT-GRKAVYMKRSGV--KGVTRTRELELIAG-SAlSETIHQEYGSRIK 162 Methanothermobacter t...
F5HAU9 155 sGFNTAGHVAHMNLRERYIP-YKKVIAEVILDKTtNIRTVINKVDNVgaESEFRTFQYEVLAG-PDdMQVQVTENACSFE 232 Neurospora crassa OR74A
2ZZN_B 171 VDIAKVYFSPRLGGERARIMKK-VSLNDVVVDMFAGVGPFSIACK---NAKKIYAIDINPHAIELLKKNIKLNKLEHKII 246
O29554  96 VDPTKAYYSVKLSGERERIARL-VGEGERVLVMFAGVGPYPIVIAklaRPREVVGVELNPHAVEYFRQNVRLNKVEGVVK 174 Archaeoglobus fulgidus
P38793 253 FDFSKVYWNSRLHTEHERLVKQyFQPGQVVCDVFAGVGPFAVPAGk--KDVIVLANDLNPESYKYLKENIALNKVAKTVK 330 Saccharomyces cerevis...
O28306 163 IDVAKVMFSLGNQAERMRIARL-VEDGEVVVDMFAGIGYFSIPIAvhsKARRIYSIEINPESYKLLLENIKLNDVGNIV- 240 Archaeoglobus fulgidus
O27268  70 IDLSRVMWSRGNINERARIPSL-VEEGETVVDMFAGIGYFSIPVAvhsDPGRVYSVELNPDSFELLKSNITLNRVEGIIE 148 Methanothermobacter t...
3A27_A  95 LDVAKIMWSQGNIEERKRMAFI-SNENEVVVDMFAGIGYFTIPLAkysKPKLVYAIEKNPTAYHYLCENIKLNKLNNVI- 172 Methanocaldococcus ja...
Q8U3G7 101 LDVARIMFSPANVKERVRMAKV-AKPNELVVDMFAGIGHLSLPIAvygKAR-VIAIEKDPYTFKFLVENIHLNKVEDRMS 178 Pyrococcus furiosus
O27901 163 VDIKDVYFSPRLANERETVAAQ-VKDGEVVLDMFAGAGPFAIAVArhgRASRVYAVDINPAAVRYIEENARLNHAEDVIV 241 Methanothermobacter t...
F5HAU9 233 FDYSKVYWNSKLEAEHRRLINM-FEPGEVVCDVMAGIGPFAVPAGk--KGVFVWANDMNPESNKYMQVAINRNKVSQYVR 309 Neurospora crassa OR74A
2ZZN_B 247 PILSDVREV----DVKGN----------------------------------------------RVIMNLPKFAHKFIDK 276
O29554 175 VIEGDVEEVvpqlSGQFD----------------------------------------------RVVMPAPYSAENFIHL 208 Archaeoglobus fulgidus
P38793 331 SFNMDGADFirqsPQLLQqwiqdeeggkitiplplkkrhrsqqhndqqppqprtkeliipshisHYVMNLPDSAISFLGN 410 Saccharomyces cerevis...
O28306 241 PILGDSQFVt--pEGVAD----------------------------------------------RVVMGHI-YCHDYLHT 271 Archaeoglobus fulgidus
O27268 149 PILGDCREVa--pELDAD----------------------------------------------RVIMGYVGRTHHFLDA 180 Methanothermobacter t...
3A27_A 173 PILADNRDVe--lKDVAD----------------------------------------------RVIMGYVHKTHKFLDK 204 Methanocaldococcus ja...
Q8U3G7 179 AYNMDNRDFp--gVDIAD----------------------------------------------RILMGYVVRTHEFIPK 210 Pyrococcus furiosus
O27901 242 AVEGDVREFlrdrECFAD----------------------------------------------HIIMNLPGSACEFLDD 275 Methanothermobacter t...
F5HAU9 310 PICEDGRTFi---HHAADsvleahkngehvliapkpps------rakkapkpepkrvdipptisHFVMNLPATAIEFLGC 380 Neurospora crassa OR74A
2ZZN_B 277 ---ALDIVEEG------------GVIHY 289
O29554 209 ---LRGKVRRG------------GFVHY 221 Archaeoglobus fulgidus
P38793 411 frgIFAAHTKGatdti--qmpwvHVHCF 436 Saccharomyces cerevisiae S288c
O28306 272 ---AIRALKER------------GVVHY 284 Archaeoglobus fulgidus
O27268 181 ---AMECVRDG------------GVIHY 193 Methanothermobacter thermautotrophicus str. Delta H
3A27_A 205 ---TFEFLKDR------------GVIHY 217 Methanocaldococcus jannaschii
Q8U3G7 211 ---ALSIAKDE------------AIIHY 223 Pyrococcus furiosus
O27901 276 ---AIRALRDG------------GVIHY 288 Methanothermobacter thermautotrophicus str. Delta H
F5HAU9 381 yrgVYAGHEDLfsaesgrklplvHVHCF 408 Neurospora crassa OR74A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap