4DOI


Conserved Protein Domain Family
Chalcone

?
pfam02431: Chalcone 
Click on image for an interactive view with Cn3D
Chalcone-flavanone isomerase
Chalcone-flavanone isomerase is a plant enzyme responsible for the isomerisation of chalcone to naringenin, 4',5,7-trihydroxyflavanone, a key step in the biosynthesis of flavonoids.
Statistics
?
PSSM-Id: 308181
View PSSM: pfam02431
Aligned: 8 rows
Threshold Bit Score: 310.563
Threshold Setting Gi: 302797725
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DOI_B        21 VDSVTFVPSVKSPASSNPLFLGGAgvrgldiqG--------K-FVIFTVIGVYLEGNAVPSLSVKWKGKTTEELTESIPF 91
gi 75171341   11 VDAFTFPPAVESPASHKRLFLGGA--------G--------K-FVIVTVIGVYLEAMALPSISAKWKGKNAKELTESVPF 73
gi 166233972  11 VENVTFPPTVKPPCSPNTFFLAGA--------GvrglqihhA-FVKFTAICVYLQYDALSFLSVKWKTKSTHQLTESDQF 81
gi 75305825    9 VEFLEFPAVVTSPASGKTYFLGGA--------GergltiegK-FIKFTGIGVYLEDKAVPSLAAKWKGKTSEELVHTLHF 79
gi 302797725  12 IEGTQFPPGLTSPVSQKSLFLAGA--------GvrsiqinpQvTITVTVLGFYFEDGILKHLSGKWSGKSGSELEKEDDF 83
gi 734414479  12 VEFLQFPAVVTPPASTKSYFLGGA--------GvrglnieeE-FVKFTGIGVYLEDKAVSSLGAKWKGKSAAELLDSLDF 82
gi 224109620  12 IENVTFPPAVKPPASNNTLFLGGAgvrgleieG--------K-FIKFTAIGVYLEDNSLQSLAAKWKGKIAKELTDSVEF 82
gi 158514257  12 VENVLFPPSVKPPGSTNDLFLGGA--------GvrgleiqgK-FVKFTAIGVYLESSAVPTLAVKWKGKTVEELADSVDF 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DOI_B        92 FREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKQLGLYTDCEAKAVEKFLEIFKEETFPPGSSILFALSPTGSL 171
gi 75171341   74 FRQLVTGEFEKLARVTMKKRLTGIQYSEKVVENCEEIMKASGKYTRSEAKAIDQFLMVFKNQDFPPGSSIIFAICPKGSL 153
gi 166233972  82 FSDIVTGPFEKFMQVTMIKPLTGQQYSEKVAENCVAIWRSLGIYTDSEAEAIDKFLSVFKDLTFPPGSSILFTVSPNGSL 161
gi 75305825   80 YRDIISGPFEKLIRGSKILPLAGAEYSKKVMENCVAHMKSVGTYGDAEAAAIEKFAEAFKNVNFAPGASVFYRQSPDGIL 159
gi 302797725  84 FTDIINAPSEKIFSVTMLKPLPGTEFSKKVMENTKQVLAESNSLGEDEEKAIEEFSKLFEDQALKPGMGPFY-VSSSSGL 162
gi 734414479  83 YRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMESVGTYSEAEEKAIEEFRNAFKDQNFPPGSTVFYKQSPTGTL 162
gi 224109620  83 FRDIVRGPFEKFMRVTMILPLTGLQYSEKVAENCVSIWKSLGIYTDAEAKAIEKFREVFKEETFPPGSSILFTLSPHGSL 162
gi 158514257  83 FRDVVTGPFEKFTKVTTILPLTGRQYSDKVSENCVAFWKSVGIYTDAEAKAIEKFNEVLKDETFPPGNSILFTHSPLGAL 162
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
4DOI_B       172 TVAFSKDDSIPE-TGIAVIENKLLAEAVLESIIGKNGVSPGTRLSVAERLSQL 223
gi 75171341  154 TIAFSKEERVPK-TGKAVIKNKLLGEAVLESMIGKNGVSPATRKSLAERLSKL 205
gi 166233972 162 TISFSGDETIPE-VTSAVIENKLLSEAVLESMIGKNGVSPAAKQSLASRLSHL 213
gi 75305825  160 GLSFSEDATIPE-KEAAVIENKAVSAAVLETMIGEHAVSPDLKRSLASRLPAv 211
gi 302797725 163 GVGFTDPDEPSNlKISSSIGNVKFANALLSTMIGKNPVSPASKACIAQRLSAL 215
gi 734414479 163 GLSFSKDETIPE-HEHAVIDNKPLSEAVLETMIGEIPVSPALKESLATRFHQF 214
gi 224109620 163 AISFSKDGSVPE-IENAVIENKLLSEAVLESMIGKHGVSPAAKQSLATTLSEL 214
gi 158514257 163 TMSFSKDGSLPE-VGNAVIENKLLTEAVLESIIGKHGVSPEAKKSLAARLSEL 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap