3A1T,2WJI,3K53,3TAH


Conserved Protein Domain Family
FeoB_N

?
pfam02421: FeoB_N 
Click on image for an interactive view with Cn3D
Ferrous iron transport protein B
Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N-terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Statistics
?
PSSM-Id: 396816
View PSSM: pfam02421
Aligned: 108 rows
Threshold Bit Score: 202.673
Threshold Setting Gi: 146274309
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3A1T_A          7 KVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTykGYTINLIDLPGT-----YSLGYSSIDEKIARDYLLK 81  Thermotoga mar...
Q2IEQ2         22 TIAIAGNPNSGKSTLVNGLAGSRLQVGNWPGVTVERKEASFEhgGRRIRLVDLPGT-----YSLSPWSQEERVARDYLVE 96  Anaeromyxobact...
ACH40650       31 TVAVAGNPNSGKSTLINAIAGTRLHVGNWAGVTVEKKEAQLDyaGRKIRLVDLPGT-----YSLSPYTQEEIVARDYLVN 105 Geobacter bemi...
jgi:Ppro_0793  18 TVAVAGNPNVGKSTLINAIAGTRLQVGNWPGVTVEKKEALFEldGLKIRLVDLPGT-----YSLSPYTQEEIIARDFLVH 92  Pelobacter pro...
WP_012469841    8 VVAVAGNPNAGKSTLINAIAGSRLHVGNWPGVTVEKKEALFDvdGRSIRLVDLPGC-----YSLSPYSQEEIITRDYLVT 82  Geobacter lovleyi
BAF69212        3 TVAFVGNPNVGKTALINDIAGSDLQVGNWPGVTVEKKEVTFTyhDEKIHLVDLPGT-----YTLTPYSLEEKITRNVICS 77  Nitratiruptor ...
WP_011981071    3 RIPFVGNPNTGKTALINAVAKSDLEVGNWPGVTVEKKEAKFTyeGEEVVLVDLPGA-----YTLSPYSLEEKISRNMLAE 77  Sulfurovum sp....
Q30PP6         16 KIALVGQPNVGKSMLINSISKANLHVGNFTGVTVEKSEVLFDykDYHFTVVDLPGT-----YALSEYSIEERVTTDYLYK 90  Sulfurimonas d...
WP_012082181    5 RAIMVGQPNVGKSSIINAISNARLHVGNFAGVTVEKKEVLIKkdDYEIDIVDLPGI-----YSLHAYTPEEHVTKKYLLN 79  Nitratiruptor ...
Q7VK59          5 TIVCVGQPNVGKSSLINKICGVHLKVGNFTGVTIEKSEAQLTykGYNLRIIDLPGIyslndYSLNDYSLEERLTKQFLEN 84  Helicobacter h...
3A1T_A         82 GDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEK 160 Thermotoga mari...
Q2IEQ2         97 ERPDVVVNVVDATNLERNLYLTVQLLELGLPVVMALNIYDEALAKGLRIDVRGLEERLGVPVIPTSATRKEGLPALLDA 175 Anaeromyxobacte...
ACH40650      106 ERPDLIVNVVDATNLERNLYLTVQLLELGIPVVMALNIYDEAQAKGYEIDVEGIEKMLGVAVVPTSATKKTGLDELFKS 184 Geobacter bemid...
jgi:Ppro_0793  93 EKPDLIVNVVDATNLERNLYLTVQLLELGIPLVMALNMSDEADAKGYRIDGDGIEQMMGIRVIPTSATRRTGLESLQKA 171 Pelobacter prop...
WP_012469841   83 EKPDLIINVVDATNLERNLYLTMQLLELGIPMIMALNIFDEAEAKGYKINTRQMEETLGIAVIPTSATRKTGLDQLLKA 161 Geobacter lovleyi
BAF69212       78 EQIDGIINVVDVTDIRRNMYLTLELVDLQKPLVVALNMFDEFTKRGYALDIERLEAILGAPCVPTIGSKGIGTKRLVKE 156 Nitratiruptor s...
WP_011981071   78 GRYEGIIDVVDTTNLRRNLYLTLELIDMQRPMVLALNMFDDFTKRGYELDTEKLQEILGIPAIPTIASRGLGTQKLIDA 156 Sulfurovum sp. ...
Q30PP6         91 EHYDLIVNVVDSTNLEKNLQLTAELMSIGKKIVIALNMSDEAQKEGIEIDDKQMSLILGITCIKVSAATKFGIETLIKA 169 Sulfurimonas de...
WP_012082181   80 ESYDVIVNVVDANVLQRNLVFTLQLLDMRKKTILVVNMIDEVEEKGGSIDADKLSKLLGIPVILTSAKQKRGVESISQK 158 Nitratiruptor s...
Q7VK59         85 EDYDVILNVLDSTNLERCLFLTTQLLELNSRMCLALNMSDEAKKEGINIDNALLGEILGVECVSVSALRGENVQLLLDT 163 Helicobacter he...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap