3LX5,3A1W


Conserved Protein Domain Family
FeoB_N

?
pfam02421: FeoB_N 
Click on image for an interactive view with Cn3D
Ferrous iron transport protein B
Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N-terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Statistics
?
Aligned: 118 rows
Threshold Bit Score: 199.588
Threshold Setting Gi: 146274309
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LX5_A          6 IALIGNPNSGKTSLFNLITGHNQRVGNWPGVTVERKSGLVKk-------NKDLEIQDLPGIYSMSPYSPEEKVARDYLLS 78  Streptococcus ...
Q2IEQ2         23 IAIAGNPNSGKSTLVNGLAGSRLQVGNWPGVTVERKEASFEh------gGRRIRLVDLPGTYSLSPWSQEERVARDYLVE 96  Anaeromyxobact...
ACH40650       32 VAVAGNPNSGKSTLINAIAGTRLHVGNWAGVTVEKKEAQLDy------aGRKIRLVDLPGTYSLSPYTQEEIVARDYLVN 105 Geobacter bemi...
jgi:Ppro_0793  19 VAVAGNPNVGKSTLINAIAGTRLQVGNWPGVTVEKKEALFEl------dGLKIRLVDLPGTYSLSPYTQEEIIARDFLVH 92  Pelobacter pro...
jgi:Glov_1785   9 VAVAGNPNAGKSTLINAIAGSRLHVGNWPGVTVEKKEALFDv------dGRSIRLVDLPGCYSLSPYSQEEIITRDYLVT 82  Geobacter lovl...
WP_011530034   33 VVVVGNPNVGKTTLINAVAGTRLKVGNWSGVTIEKREARLTh------aGRSVYLLDLPGAYSLSPHTPEELITRTALLD 106 Deinococcus ge...
BAF69212        4 VAFVGNPNVGKTALINDIAGSDLQVGNWPGVTVEKKEVTFTy------hDEKIHLVDLPGTYTLTPYSLEEKITRNVICS 77  Nitratiruptor ...
USDA:Abu_0551   8 IALVGQPNVGKSMLINSISGAKLKVGNFPGVTVSKEEVFFKy------kDYEFQIIDLPGSYSLNNYSIEEKITKDFLYN 81  Arcobacter but...
Q30PP6         17 IALVGQPNVGKSMLINSISKANLHVGNFTGVTVEKSEVLFDy------kDYHFTVVDLPGTYALSEYSIEERVTTDYLYK 90  Sulfurimonas d...
BAF71763        6 VALAGQPNVGKSSLINAISNAKLKVGNFSGVTVDKTEVVFKmcheqsceDYEVHIIDLPGAYSLTEYTIEEKVTKSFLQS 85  Sulfurovum sp....
3LX5_A         79 QRADSILNVVDATNLERNLYLTTQLIETGIPVTIALNMIDVLDGQGKKINVDKLSYHLGVPVVATSALKQTGVDQVVKK 157 Streptococcus t...
Q2IEQ2         97 ERPDVVVNVVDATNLERNLYLTVQLLELGLPVVMALNIYDEALAKGLRIDVRGLEERLGVPVIPTSATRKEGLPALLDA 175 Anaeromyxobacte...
ACH40650      106 ERPDLIVNVVDATNLERNLYLTVQLLELGIPVVMALNIYDEAQAKGYEIDVEGIEKMLGVAVVPTSATKKTGLDELFKS 184 Geobacter bemid...
jgi:Ppro_0793  93 EKPDLIVNVVDATNLERNLYLTVQLLELGIPLVMALNMSDEADAKGYRIDGDGIEQMMGIRVIPTSATRRTGLESLQKA 171 Pelobacter prop...
jgi:Glov_1785  83 EKPDLIINVVDATNLERNLYLTMQLLELGIPMIMALNIFDEAEAKGYKINTRQMEETLGIAVIPTSATRKTGLDQLLKA 161 Geobacter lovle...
WP_011530034  107 EAPDAVINVLDAGNLERNLYLTLQLLDFRVPVAVALNLVDEARDKGLTVDPAALARALGVPVVETVASRSEGTGALLEQ 185 Deinococcus geo...
BAF69212       78 EQIDGIINVVDVTDIRRNMYLTLELVDLQKPLVVALNMFDEFTKRGYALDIERLEAILGAPCVPTIGSKGIGTKRLVKE 156 Nitratiruptor s...
USDA:Abu_0551  82 STYDLILNVVDSTNLQRNLLLTTELLLLNKKMIIALNMIDEANDELIEINDAELGSILGRPCVKTSASKKIGIQTLLEE 160 Arcobacter butz...
Q30PP6         91 EHYDLIVNVVDSTNLEKNLQLTAELMSIGKKIVIALNMSDEAQKEGIEIDDKQMSLILGITCIKVSAATKFGIETLIKA 169 Sulfurimonas de...
BAF71763       86 DEYDIIVNVVDSTNLQRNLLFTTQLLETGKKVVVALNMSDEAEKEGIEIDEKQLSAILGVPCIKTSANTKEGIEELKKA 164 Sulfurovum sp. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap