6GIR,2DQ3,3QNE,1SRY


Conserved Protein Domain Family
Seryl_tRNA_N

?
pfam02403: Seryl_tRNA_N 
Click on image for an interactive view with Cn3D
Seryl-tRNA synthetase N-terminal domain
This domain is found associated with the Pfam tRNA synthetase class II domain (pfam00587) and represents the N-terminal domain of seryl-tRNA synthetase.
Statistics
?
PSSM-Id: 367073
View PSSM: pfam02403
Aligned: 84 rows
Threshold Bit Score: 71.0846
Threshold Setting Gi: 11134954
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GIR_A             1 MVDINLFREekgnNPEIIRESQRRRFaSVEIVDEIIKLDKEWRQRQFEVDSFRKEFNKLNKQVAQLKIKK--EDASEIIQ 78  thale cress
ACR27999           1 MLDIQLLRK----DLDGVAKRLADRg-YILDVAAFSSLEAERRAIQTRTEELQARRNSLSKQIGAMKGRG--EDTSAVMA 73  Burkholderi...
Q87QP1             1 MLDSKLLRT----ELDETAAKL-ARRgFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQKMAAGdkEGAEEIKK 75  Vibrio para...
P57398             1 MLNPYLLRN----ELHLTAKKL-LKKgYKLNISKISSMEEKRKTLQIQTENLQFKHNALSNLFKENKNIK--NKNELLRH 73  Buchnera ap...
P59553             1 MLNPNLLRN----HIEFVFKNL-ARRgFSLDVKQFTEMEKKRKILQTKVEELQSRHNTLSKHIGRIKLIH--PNIQCMKE 73  Buchnera ap...
Q8D265             1 MIDHKLIIK----NIEEVCKKLILRN-FYLDKKKILLQDQKRKILQIEVEKLQNKRNLQSKIISKIKINN--KNIDIYKN 73  Wiggleswort...
O51244             1 MLDLKFIRD----NLDLVKRSIKARG-LVLDIDKLIYLDDKRKKLITKIGELNAKRNENSSKMQENLDK---VLKISLIE 72  Borreliella...
AQK49050          73 aIDFKWIRD----NRDAVADNIRTRn-STANLDLVFELYDQYLTLQKEVERLRAERNAVANKMKGKLDPS---VRQALVE 144 Zea mays
JCVI:AT1G11870.3  78 aIDFKWIRD----NKEAVEINIRNRn-SNANLEAVLQLYENMVNLQKEVERLREERNNVAKKMKGKLEP---SERERLVE 149 thale cress
O83653             1 MLDYRFIRE----NVDAVKENVKVRN-VHADVDAIVHLYDQRVKLLAELQELQRARNENAQTMKSSLDAL---ARSACVE 72  Treponema p...
6GIR_A            79 QTEKNKQDSTAKEAEVREAYAALKAKLEQVGNLV 112 thale cress
ACR27999          74 EVGGIGDEMKASAAKLDEIQSAMSELMLGMPNLa 107 Burkholderia glumae BGR1
Q87QP1            76 QIGTLGSDLDAKKVELEQVMAQLDEFTLSVPNIP 109 Vibrio parahaemolyticus RIMD 2210633
P57398            74 QVIQSSKDLNASKIELNSLKEKIHHFSMCIPNIP 107 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
P59553            74 RIITLKKKIDVMKKELKILLEQIHIFLMNIPNLP 107 Buchnera aphidicola str. Bp (Baizongia pistaciae)
Q8D265            74 KSNKINILLNEKKQKLKKIKKEIDNYLSTIPNIL 107 Wigglesworthia glossinidia endosymbiont of Glossina brevi...
O51244            73 TGKILKKQLIDLEEELERVSVDFDLENKKVPNIL 106 Borreliella burgdorferi B31
AQK49050         145 EGKNLKEGLIALEEDLVQLTDKLQLEAQSIPNTt 178 Zea mays
JCVI:AT1G11870.3 150 EGKNLKESLVTLEEDLVKLKDELQHVAQSIPNMt 183 thale cress
O83653            73 TGRALKDRIAHSERLLVQISDQLLSATQALPNMT 106 Treponema pallidum subsp. pallidum str. Nichols
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap