2DQ3,3QNE,1SRY


Conserved Protein Domain Family
Seryl_tRNA_N

?
pfam02403: Seryl_tRNA_N 
Click on image for an interactive view with Cn3D
Seryl-tRNA synthetase N-terminal domain
This domain is found associated with the Pfam tRNA synthetase class II domain (pfam00587) and represents the N-terminal domain of seryl-tRNA synthetase.
Statistics
?
PSSM-Id: 334921
View PSSM: pfam02403
Aligned: 83 rows
Threshold Bit Score: 67.2268
Threshold Setting Gi: 11134954
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DQ3_A         2 IDINLIREKPDYVKERLATRdKeLVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREG--KDTTEIQNRVKE 79  Aquifex aeolicu...
Q5F752         2 LDIQLLRSNTAAVAERLARRg--YDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGALKGQGkhEEAQAAMDQVAQ 79  Neisseria gonor...
Q8XWY3         2 LDIQLLRKDIDAVAARLN-D-RgYELDVAGFAALEAERKAIQTRTEELQARRNSLSKQIGMLKGKG--EDASAVMAEVAG 77  Ralstonia solan...
Q8PA92         2 LDPALLRQHPADLAERLRST-RgFDLNTAELESLESERKRIQVRTQELQSLRNSKSKAIGQAKAKG--EDVAALMAEVAG 78  Xanthomonas cam...
Q9PB58         2 LDPTLLRQQLAKLAECLSTV-RgFTLDVAALEALESERKRIQVHTQELQSLRNSKSKAIGQARSKG--EDVSSLMAEVAA 78  Xylella fastidi...
Q87QP1         2 LDSKLLRTELDETAAKL-AR-RgFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQKMAAGdkEGAEEIKKQIGT 79  Vibrio parahaem...
Q8EEQ9         2 LDPKFLRNELAVTAERL-AT-RgFILDVAHLTQLEEKRKSLQVATEELQASRNAISKSIGQAKARG--EDVDAIMAQVGD 77  Shewanella onei...
P57398         2 LNPYLLRNELHLTAKKL-LK-KgYKLNISKISSMEEKRKTLQIQTENLQFKHNALSNLFKENKNIK--NKNELLRHQVIQ 77  Buchnera aphidi...
P59553         2 LNPNLLRNHIEFVFKNL-AR-RgFSLDVKQFTEMEKKRKILQTKVEELQSRHNTLSKHIGRIKLIH--PNIQCMKERIIT 77  Buchnera aphidi...
WP_017424257   2 LDIQLLRKDLDGVAKRLADRg--YILDVAAFSSLEAERRAIQTRTEELQARRNSLSKQIGAMKGRG--EDTSAVMAEVGG 77  Burkholderia gl...
2DQ3_A        80 LKEEIDRLEEELRKVEEELKNTLLWIPNLP 109 Aquifex aeolicus VF5
Q5F752        80 IKTDLEQAAADLDAVQKELDAWLLSIPNLP 109 Neisseria gonorrhoeae FA 1090
Q8XWY3        78 IGDELKASAAQLDVVQGRLQDLLLSIPNVP 107 Ralstonia solanacearum GMI1000
Q8PA92        79 FGDELKASEDALDVIRAQLEGIALGIPNLP 108 Xanthomonas campestris pv. campestris str. ATCC 33913
Q9PB58        79 FSDDLKASEIALEEIRTELEKVALGIPNLP 108 Xylella fastidiosa 9a5c
Q87QP1        80 LGSDLDAKKVELEQVMAQLDEFTLSVPNIP 109 Vibrio parahaemolyticus RIMD 2210633
Q8EEQ9        78 LGAQLDAKKVELAAVLEEVNAIAMSMPNLP 107 Shewanella oneidensis MR-1
P57398        78 SSKDLNASKIELNSLKEKIHHFSMCIPNIP 107 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
P59553        78 LKKKIDVMKKELKILLEQIHIFLMNIPNLP 107 Buchnera aphidicola str. Bp (Baizongia pistaciae)
WP_017424257  78 IGDEMKASAAKLDEIQSAMSELMLGMPNLa 107 Burkholderia glumae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap