2DQ3,3QNE,1SRY


Conserved Protein Domain Family
Seryl_tRNA_N

?
pfam02403: Seryl_tRNA_N 
Click on image for an interactive view with Cn3D
Seryl-tRNA synthetase N-terminal domain
This domain is found associated with the Pfam tRNA synthetase class II domain (pfam00587) and represents the N-terminal domain of seryl-tRNA synthetase.
Statistics
?
PSSM-Id: 334921
View PSSM: pfam02403
Aligned: 83 rows
Threshold Bit Score: 67.2268
Threshold Setting Gi: 11134954
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2DQ3_A         2 IDINLIREKPDYVKERLATRdKeLVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREG--KDTTEIQNRVKE 79
gi 67461600    2 LDIQLLRSNTAAVAERLARRg--YDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGALKGQGkhEEAQAAMDQVAQ 79
gi 30173189    2 LDIQLLRKDIDAVAARLN-D-RgYELDVAGFAALEAERKAIQTRTEELQARRNSLSKQIGMLKGKG--EDASAVMAEVAG 77
gi 30173176    2 LDPALLRQHPADLAERLRST-RgFDLNTAELESLESERKRIQVRTQELQSLRNSKSKAIGQAKAKG--EDVAALMAEVAG 78
gi 30173217    2 LDPTLLRQQLAKLAECLSTV-RgFTLDVAALEALESERKRIQVHTQELQSLRNSKSKAIGQARSKG--EDVSSLMAEVAA 78
gi 31340446    2 LDSKLLRTELDETAAKL-AR-RgFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQKMAAGdkEGAEEIKKQIGT 79
gi 30173158    2 LDPKFLRNELAVTAERL-AT-RgFILDVAHLTQLEEKRKSLQVATEELQASRNAISKSIGQAKARG--EDVDAIMAQVGD 77
gi 11134954    2 LNPYLLRNELHLTAKKL-LK-KgYKLNISKISSMEEKRKTLQIQTENLQFKHNALSNLFKENKNIK--NKNELLRHQVIQ 77
gi 29839436    2 LNPNLLRNHIEFVFKNL-AR-RgFSLDVKQFTEMEKKRKILQTKVEELQSRHNTLSKHIGRIKLIH--PNIQCMKERIIT 77
gi 515993674   2 LDIQLLRKDLDGVAKRLADRg--YILDVAAFSSLEAERRAIQTRTEELQARRNSLSKQIGAMKGRG--EDTSAVMAEVGG 77
                         90       100       110
                 ....*....|....*....|....*....|
2DQ3_A        80 LKEEIDRLEEELRKVEEELKNTLLWIPNLP 109
gi 67461600   80 IKTDLEQAAADLDAVQKELDAWLLSIPNLP 109
gi 30173189   78 IGDELKASAAQLDVVQGRLQDLLLSIPNVP 107
gi 30173176   79 FGDELKASEDALDVIRAQLEGIALGIPNLP 108
gi 30173217   79 FSDDLKASEIALEEIRTELEKVALGIPNLP 108
gi 31340446   80 LGSDLDAKKVELEQVMAQLDEFTLSVPNIP 109
gi 30173158   78 LGAQLDAKKVELAAVLEEVNAIAMSMPNLP 107
gi 11134954   78 SSKDLNASKIELNSLKEKIHHFSMCIPNIP 107
gi 29839436   78 LKKKIDVMKKELKILLEQIHIFLMNIPNLP 107
gi 515993674  78 IGDEMKASAAKLDEIQSAMSELMLGMPNLa 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap