3DXX,2VDV,3CKK,2FCA


Conserved Protein Domain Family
Methyltransf_4

?
pfam02390: Methyltransf_4 
Click on image for an interactive view with Cn3D
Putative methyltransferase
This is a family of putative methyltransferases. The aligned region contains the GXGXG S-AdoMet binding site suggesting a putative methyltransferase activity.
Statistics
?
PSSM-Id: 334917
View PSSM: pfam02390
Aligned: 21 rows
Threshold Bit Score: 185.184
Threshold Setting Gi: 6225501
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DXX_A        34 EAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEE--GLSNLRVMCHDA---VEVLHKMIPDNSLRM 108
gi 14194921   16 ipnleVEIGFGRGDFIVKLAKENPDKNFFGIEISQISIEKLMKRVGKK--GLKNVYCTNVDAywgFYFL---FRDNYVEN 90
gi 1176095    71 DNPVVLEIGFGMGKSLVDMAFANPDKNYLGIEVHTPGVGACIAYAVEK--GVTNLRVICHDA---TEILRDSIADGALGG 145
gi 14194922   80 PAPLVVEIGFGMGSATAAIAARNPHLSYLGIEVYRAGIGRLLRKIEAE--RLHNLRIIEHDA---LDVLRTMIAPQTLAG 154
gi 615880598  76 DAPVVLEIGSGSGTSTLAMAKAEPHVDVIAVDVYRRGLAQLLCAIDKVgsDGINIRLILGNA---VDVLQHLIAPDSLCG 152
gi 14194930   55 STLVVLEVGCGSGTATLAMAQHEPDIDVIAVEVYRRGLAQLLCAIDRD--QVHNIRMIHGNA---LYVLQYLIAPRSLTG 129
gi 14194919  118 QAPILIEIGFGSGRHLIELAKNNPTKTCLGIEIHTPSIAQALKQIELL--DLKNLHILQGDG----RLVLESMPNHRCEK 191
gi 14194923   48 NGPICCELCSGNGDWVVEQALKDASVNWIAVEKRFDRVRKIWSKMGNY--RVNNLLIVCGEA---QTFFSHYVSDASFQK 122
gi 14194920   38 DNPIHIEVGTGKGQFISGMAKQNPDINYIGIELFKSVIVTAVQKVKDS--EAQNVKLLNIDA----DTLTDVFEPGEVKR 111
gi 2496397    30 SESLFVEIGCGKSWFLSQQAQQNPKCFFVGIEREPTIVLKAINKVNRLevKPRNLLITCLDA----NQLTEYLKPQSISK 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DXX_A       109 VQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATD---WEPYAEHMLEVMSSIDGYKNLSESNDYVPRPAS- 184
gi 14194921   91 IYMNYPDPWFKKRHHKRRLTKPERLYMFAKKLKLGGEIRIRTDnyeFLEFTKESAKVLDCF----------EVEEGTLNv 160
gi 1176095   146 LQLFFPDPWHKAKHHKRRIVQPHFVTQVIQKLGENGFIHMATD---WENYAEQMLEVLSANTDLVNTSKNGDYIPRPDf- 221
gi 14194922  155 LHIFFPDPWPKTRHHKRRLLYRPRTDLLARALAPGGYLYAVTD---WAEYARRAQEELARTPSLT-------WAPQGARp 224
gi 615880598 153 VRVFFPDPWPKARHHKRRLLQPATMALIADRLVPSGVLHAATD---HPGYAEHIAAAGDAEPRLVRVDPDTELL--PISv 227
gi 14194930  130 VRVFFPDPWPKVRHHKRRFLQPATVELIADRLLPGGVLHTATD---HPDYAKQIAKFGDGEPLLSRADGRTQL---PISt 203
gi 14194919  192 IFVHFPVPWNEKKH--RRVLSEKFLNEALRVLKPRGFLELRTD---DSLYFEDSLKLALKNFQCEIEIKKNAQIP----- 261
gi 14194923  123 IVVNFPDPWPKFRHRKHRLFQDLFVQDMMRTLVVGGQLTLATD---DYNYLVNAITVMLKY-----------LSPGLKSp 188
gi 14194920  112 VYLNFSDPWPKKRHEKRRLTYSHFLKKYEEVMGKGGSIHFKTDnrgLFEYSLKSFSEYGLLLTYVSLDLHNSNLEG---- 187
gi 2496397   106 IFINFPDPWPKKRHTLRRLTAPHFLKQFHQLLKKQGLIEFKTDndqLFEFTLEVLQKTVAH--FKIIEQTTDLHNSPLTs 183
                        170       180
                 ....*....|....*....|....*...
3DXX_A       185 -RPVTK-------FEQRGHRLGHGVWDL 204
gi 14194921  161 kEPLTK-------YEQKWLSMGKTLYKL 181
gi 1176095   222 -RPLTK-------FEARGYKLGHGVWDL 241
gi 14194922  225 wRPATE-------FERKAQTQGRAIHEL 245
gi 615880598 228 vRPATK-------YERKAQLGGGAVIEL 248
gi 14194930  204 vRPTTK-------YETKAQHAGNVVTEL 224
gi 14194919  262 --VVSK-------YEARWNKLKKDIYDL 280
gi 14194923  189 hYINVKdnyggswFENLWRSKGQEIFCT 216
gi 14194920  188 -NIMTE-------YEEKFSALGQPIYRA 207
gi 2496397   184 tNIMTE-------YEQRFVSLGVKIKKL 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap