1LRZ


Conserved Protein Domain Family
FemAB

?
pfam02388: FemAB 
Click on image for an interactive view with Cn3D
FemAB family
The femAB operon codes for two nearly identical approximately 50-kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan. These proteins are also considered as a factor influencing the level of methicillin resistance.
Statistics
?
PSSM-Id: 334916
View PSSM: pfam02388
Aligned: 28 rows
Threshold Bit Score: 355.784
Threshold Setting Gi: 81344900
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LRZ_A         6 LTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGyETHLVGIKNNnNEVIAACLLTAVPVMKVFkYFYSNRGPVIDYENQEL 85  Staphylococcus ...
Q5HLI6         6 LTSEEFEQFTSEN-FSHYTQSSIHYNNRSKTKgDVHLVGVKDDqEDVIAACLLTEARSLKFFkYFYTHRGPVMDFNNLVL 84  Staphylococcus ...
Q830W0         8 IPAEVHDTFVKNHPLCNLLQSSSWAKVK--DNwGSEIVGVYEKdTLVASSLVLIKPLPA-GFtMLYTPRGPVMDYTNERL 84  Enterococcus fa...
Q8E152         8 ISEKEYDAFAIASSQTNLLHSSKWAQVK--SNwQNERLGFYKDdQLVAVASILIKSLPL-GFtMLYIPRGPIMDYSNKEL 84  Streptococcus a...
Q99ZJ6        12 ISEEEHDSFVKEHQQISVLQGSDWAKIK--NQwQNERIGIYKEeKQVASLSLLIKLLPL-GRsIIYIPRGPVMDYLDRDL 88  Streptococcus p...
Q8E153         5 ITAVEHDRFVSESNQTNLLQSSNWPKVK--DNwGSQLLGFFDGeTQIASASILIKSLPL-GFsMLYIPRGPIMDYSNLDI 81  Streptococcus a...
Q8DV07         8 ISKEEHDNFIKNSSQTNLLQSSSWAKVK--DEwENERIGFYQDsKLVASASILIRPLPL-GMtMFYIPRGPVMNYQDKDL 84  Streptococcus m...
Q5M449         8 LSTSEHDRFVIDSPQTNLLQSSSWAKIK--DSwGNDRLGFYQDdKLVAVASVLIQPLPL-GFsMIYIPRGPIMDYQDKEL 84  Streptococcus t...
Q8DQR1         8 ipTLEYDQFVKEHELANVLQSSAWEEVK--SNwQHEKFGVYREeKLLATASILIRTLPL-GYkMFYIPRGPILDYGDKEL 84  Streptococcus p...
WP_011773731   6 LSDADFETFAKGHPQGSFIQSMDLTRFQRARGqEVELFGVTRGgSLIAAGKLVYTSNRV-GYkTADCAKGPLMDYSDPTV 84  Micrococcaceae
1LRZ_A        86 VHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITg--N-AGNDWFFDKMSNLGFEHTGFHKGFDpvLQIRYHSVLD 162 Staphylococcus ...
Q5HLI6        85 VRFFFKSLTAYLKKHNCLYVLVDPYVLENLRQPNGEIIe--S-FDNRALIKTMEELGYKHQGYTVGYDtmSQIRWLSVLN 161 Staphylococcus ...
Q830W0        85 VSYFMAELKKFGKKKRALFIKMDPAVHYQDFHLGEEHQp--H-AEATSIIETLKEAGAKYQGLTMDMGatIQPRFQANIY 161 Enterococcus fa...
Q8E152        85 VNFVLKTLKNFGRKKRAVFAKFDPALLLRQYHLKEENVaeeI-DESRQAIDNLKSAGAQWIGPTKAISetIQPRFQANIY 163 Streptococcus a...
Q99ZJ6        89 VAFTMKTLKDYGKTKKALFIKYDPAILLKQYALGQEEEe--K-PLALAAIKNLQEAGVHWTGLTMEIAdsIQPRFQANIY 165 Streptococcus p...
Q8E153        82 VTKVLKDLKAFGKKQRALFIKCDPLIYLKMVNAKDFENspdE-KEGLIAIDHLQRAGADWTGRTTDLAhtIQPRFQANLY 160 Streptococcus a...
Q8DV07        85 VNFVLTSLKKFAKRKRALFIKFDPFILLNHHQIDEEAIn--N-PQAQTIIDTLKHLGCEWLGQTSDMGetIQPRFQANIY 161 Streptococcus m...
Q5M449        85 LAFVITSLKKYAKTKRALFVKFDPSLFVTKNLISQEVNi--N-EDTLSIAKDIQALGVEWTGLTEDMAenIQPRFQANIY 161 Streptococcus t...
Q8DQR1        85 LNFAIQSIKSYARSKRVVFVTFDPSICLSQSLINQEKTe--F-PENLAIIDSLQQMGVRWSGKTEEMGdtIQPRIQAKIY 161 Streptococcus p...
WP_011773731  85 VSFVVEQLKKHAASKKAAELCISPNIRYIARDEEGAEHp--EvEDNRPLLKELEGLGFKHQGFDMNFAn---INWMFIKQ 159 Micrococcaceae
1LRZ_A       163 LKDKTA-DDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMEDTSESKAFADRDDKFYYNRLKYYKDR-VLVPL 240 Staphylococcus ...
Q5HLI6       162 LKDKSE-DQLLKEMDYQTRRNIKKTYEMGVKVKTLPIEETNTFFELFKMAEEKHGFKFREEPYFVEMQKTYEDH-AMLKL 239 Staphylococcus ...
Q830W0       162 REDFSE-E----QLSKSTKKMIKTAEKKGVVVQQGHVDFVDEFEKVIQSTMERQHISLRNSDYFKKLLNIYPED-SFIML 235 Enterococcus fa...
Q8E152       164 TKANIE-E----NFPKHTKRLIKDAKHRGVQIYRANIDDLPKFATVVALTENRKGVALRNENYFHQLMTIYGED-AYLYL 237 Streptococcus a...
Q99ZJ6       166 TQENLE-M----QFPKHTRRLIKDAKQRGVKTYRVSQSELHKFSKIVSLTEKRKNISLRNEAYFQKLMTTYGDK-AYLHL 239 Streptococcus p...
Q8E153       161 ANQFGL-D----KMSKKTRQAIRTSKNKGVDIQFGSHELLEDFAELMKKTEDRKGINLRGIDYYQKLLDTYPNN-SYITM 234 Streptococcus a...
Q8DV07       162 AEGFSE-A----NLSKKIRQSIRTAKNKGVSIRFGGYELLADFSDLMKKTEDRKSIHLRGIDYYRKLLDNYPQH-SFITL 235 Streptococcus m...
Q5M449       162 KEDFTE-E----QLSKSTKQAIRTARNKGISVQFGGTELLDQFADLMKKTEARKNIHLRGIDYYEKLLTTYPES-SYITL 235 Streptococcus t...
Q8DQR1       162 KENFEE-D----KLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKKLLDNFKDK-AYITL 235 Streptococcus p...
WP_011773731 160 LNGIADsEELIMGMNYRTRKAIRKAEKNGVYLEQATLETLDEFYNALSTAGDEKGFTYREREYYEQLLRNTSDEfTKLMM 239 Micrococcaceae
1LRZ_A       241 AYINFDEYIKELNEERDILNKDLNKALKDIEKRPEnKKAHNKRDNLQQQLDANEQKIEEGKRLqEEHGNE-LPISAGFFF 319 Staphylococcus ...
Q5HLI6       240 AYIDLQDYLDTLQTKHQNLNQQLKDVEKTLEENPNsKKNKTKHTQVKQQFDSNARKIRQTKEKiAEEGQV-LHLAAALYI 318 Staphylococcus ...
Q830W0       236 AQVNLKERLDSTRQRYDKNQKDLSNLKE---------NQVKKRHNLEELDASLTRELKELEENiAEAGEI-VTVAGALAV 305 Enterococcus fa...
Q8E152       238 AKVNLPKRLAQFKEQLLQIQKDLSETPS---------HQKSRLTRLNQQEASVKQYILEFQEFsKKYPDE-PVIAGILSI 307 Streptococcus a...
Q99ZJ6       240 AKVNIPQKLDQYRQQLILINQDITRTQA---------HQKKRLKKLEDQKASLERYITEFEGFtDQYPEE-VVVAGILSI 309 Streptococcus p...
Q8E153       235 ASLDVAKRLEKIEKECQIAQSERIKSLEL--------NREKKVKQHQGTIDRLNKEIDFLKEAqKAYDRDiIPLAATLTL 306 Streptococcus a...
Q8DV07       236 ASLNLKERLTELESQRKKAQNNLAKFGDN--------VKPSKIDNTKKEIERLSDEIAFLQEHlSQGKDT-VPLSGTLSL 306 Streptococcus m...
Q5M449       236 STLDLPARLKDLNKQLEKNIADAAKFTEK--------TKPGKIENNKQEYKRLSEEIAFLQEKvDAGNKI-VPLSGTLVL 306 Streptococcus t...
Q8DQR1       236 ATLDVSKRSQELEEQLAKNRALEETFTES--------TRTSKVEAQKKEKERLLEELTFLQEYiDVGQAR-VPLAATLSL 306 Streptococcus p...
WP_011773731 240 AKINIPEYRASITERLDAESKTLAELKREVEETGs-KKKANRVKVVQDLVDSYERSLKDIERFpDSVG-V-ATVAAIHFA 316 Micrococcaceae
1LRZ_A       320 INPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTedaED---A---GVVKFKKGYNAEIIEY 393 Staphylococcus ...
Q5HLI6       319 YNDHEVYYLSSGSNPKYNAYMGAYRLQWDMIQFAKEHNIDRYNFYGVTGDFS---EN---AedaGVQKFKEGFNAKIYEY 392 Staphylococcus ...
Q830W0       306 TFGPTSEILYAGLDDRYKRYMPTYVTWRDAIQECFNRGCESCNMGGLEGSLN---D--------GLIKFKANFNPTINEF 374 Enterococcus fa...
Q8E152       308 RFGNVLEMLYAGMDDSFRKFYPQYLLNARVFEDAFKNDIVSANLGGVEGSLN---D--------GLTKFKSNFNPMFEEY 376 Streptococcus a...
Q99ZJ6       310 SYGNVMEMLYAGMNDDFKKFYPQYLLYPNVFQDAYQDGIIWANMGGVEGSLD---D--------GLTKFKANFAPTIEEF 378 Streptococcus p...
Q8E153       307 EFGNTSENIYAGMDDYFKSYSAPIYTWFETAQRAFERGNIWQNMGGIENDLS---G--------GLYHFKSKFEPIIEEF 375 Streptococcus a...
Q8DV07       307 EFGKTSENVYAGMDDEFRRYQAAIYTWFATANHAFERGSHWQNMGGIENDLS---G--------GLYNFKSKFKPEIEEF 375 Streptococcus m...
Q5M449       307 EFGNTAENIYAGMDEDYRRYQPAILTWFETANHAFERGAEWQNMGGIENSLD---G--------GLYNFKSKFNPRIEQF 375 Streptococcus t...
Q8DQR1       307 EFGTTSVNIYAGMDDDFKRYNAPILTWYETARYAFERGMVWQNLGGVENSLN---G--------GLYHFKEKFNPTIEEY 375 Streptococcus p...
WP_011773731 317 CSGDELVCVIGGTVQDYIYFNGATSLYWGMMLHALNNGYSRYNFYGTFGIQG---QDetgH---GGYEFKKGFGGEVVQL 390 Micrococcaceae
1LRZ_A       394 VGDFIKPINKPVYAAYTALK---K 414 Staphylococcus aureus
Q5HLI6       393 IGDFIKPIKPLFYKVKQELE---S 413 Staphylococcus epidermidis RP62A
Q830W0       375 IGEFDLPVNKLLFKASEYAY---K 395 Enterococcus faecalis
Q8E152       377 IGEFNLAINPLLYKLANLAYtirk 400 Streptococcus agalactiae serogroup V
Q99ZJ6       379 IGEFNLPVSP-LYHIANTMY---K 398 Streptococcus pyogenes serotype M1
Q8E153       376 IGEFNIPVNRLLYKASNYVYalrk 399 Streptococcus agalactiae serogroup V
Q8DV07       376 IGEFNLPVSP-LYKLANIAYtirK 398 Streptococcus mutans
Q5M449       376 IGEFNLPVSP-FYGLANFAY---K 395 Streptococcus thermophilus LMG 18311
Q8DQR1       376 LGEFTMPTHP-LYPLLRLAldfrk 398 Streptococcus pneumoniae R6
WP_011773731 391 VGDFVAPVNPLIFHGYRAVR---K 411 Micrococcaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap