4LXL,5YKN


Conserved Protein Domain Family
JmjN

?
pfam02375: JmjN 
Click on image for an interactive view with Cn3D
jmjN domain
Statistics
?
Aligned: 289 rows
Threshold Bit Score: 48.024
Threshold Setting Gi: 1418043954
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LXL_A         36 MTFRPTMEEFKDFNKYVAYIESQGAhRAGLAKIIP 70   human
OWR43782      936 PVFYPTLEEFSDPMAYLEKIMKFTK-KYGIFKLVa 969  Danaus plexippus plexippus
EPS98789      131 PVFHPTLEQWKDPLAYVKSISDNAR-KYGMCKIVP 164  Fomitopsis pinicola FP-58527 SS1
EED77799      160 PVFRPTLEQFKDPLAYIKSISEKAK-AYGMCKIVP 193  Postia placenta Mad-698-R
EKM79933      164 PEYYPTTEQFKDPMEYIKSIAEEAK-EYGICKIVP 197  Agaricus bisporus var. burnettii JB137-S8
EFJ01719      160 PEYHPTAEQFQDPMAYIQSIAEEAK-QFGICKVVP 193  Schizophyllum commune H4-8
ESK86819      159 PEFYPSAEEFKDPMAYISSISEKAK-EHGICKIVP 192  Moniliophthora roreri MCA 2997
XP_001837509  164 PEFHPTTEEFKDPMAYIRSISDRAK-DYGICKIIP 197  Coprinopsis cinerea okayama7#130
EHY54178       77 PTFRPTEAEFRDPMAYIRSISEKAS-KYGICKIIP 110  Exophiala dermatitidis NIH/UT8656
EGO02116      151 PVFYPTLDEFNDPMTYVRSISDSAK-DYGICKIVP 184  Serpula lacrymans var. lacrymans S7.3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap