3ZQ6,3UG6,5BW8


Conserved Protein Domain Family
ArsA_ATPase

?
pfam02374: ArsA_ATPase 
Click on image for an interactive view with Cn3D
Anion-transporting ATPase
This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.
Statistics
?
Aligned: 13 rows
Threshold Bit Score: 333.959
Threshold Setting Gi: 6647425
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ZQ6_A  12 GKTTfvfiggkggvgkttISAATALW--MARSGKKTLVISTDPAHSLSDSLER------EIGHTPTKIT--ENLYAVEID 81  Methanothermobacter t...
O52027  31 GKST--------------VSCATATW--LADNDYDTLLVTTDPAPNLSDIFNQ------DIGHEVTAIDdvPNLSAIEID 88  Halobacterium salinar...
O66674  13 GKTT--------------ASSAFAVK--LSEQGKKVLLLSTDPAHSLSDVFNT-------ELQGETKLS--ENLTVKEID 67  Aquifex aeolicus VF5
O66908  13 GKTT--------------ISAATGYK--LSQLGKKVIVVSLDPAHSLADSFDVpeeerrKAKGLPIKIN--ENLEIQEID 74  Aquifex aeolicus VF5
Q55794  13 GKTS--------------VAAATGLR--CAELGHKTLVLSTDPAHSLADSFDL------ELGHEPRLVK--ENLWGAELD 68  Synechocystis sp. PCC...
Q46366  13 GKTS--------------VSAATAVR--LSEMGHRTLVLSTDPAHSLSDSFNI------QLGAEPTKIK--ENLHAIEVN 68  Chlorobaculum tepidum...
Q12154  30 GKTT--------------SSCSIAIQmaLSQPNKQFLLISTDPAHNLSDAFGE------KFGKDARKVTgmNNLSCMEID 89  Saccharomyces cerevis...
O43681  49 GKTT--------------CSCSLAVQ--LSKGRESVLIISTDPAHNISDAFDQ------KFSKVPTKVKgyDNLFAMEID 106 human
Q58542  38 GKTT--------------MSAATGVY--LAEKGLKVVIVSTDPAHSLRDIFEQ------EFGHEPTKVKgyDNLYVVEID 95  Methanocaldococcus ja...
O27555  26 GKTT--------------ISAATALW--MARSGKKTLVISTDPAHSLSDSLER------EIGHTPTKIT--ENLYAVEID 81  Methanothermobacter t...
P30632  30 GKTT--------------CSCSLAAQ--LSKVRERVLLISTDPAHNISDAFSQ------KFTKTPTLVEgfKNLFAMEID 87  Caenorhabditis elegans
3UG6_A  38 GKTT--------------MSAATGVY--LAEKGLKVVIVSTDPAHSLRDIFEQ------EFGHEPTKVKgyDNLYVVEID 95  Methanocaldococcus ja...
5BW8_A  49 GKTT--------------SSCSIAIQmaLSQPNKQFLLISTDPAHNLSDAFGE------KFGKDARKVTgmNNLSCMEID 108 Saccharomyces cerevis...
3ZQ6_A  82 P--------Ev------aMEEYQAKLQEQAAMNPGM---GlDMLQDQMDMASMS-PGIDEAAAFDQFLRYMT------TD 137 Methanothermobacter t...
O52027  89 P--------D--------VAAEEYRQETIEPMRALL---G-DEEIQTVEEQLNS-PCVEEIAAFDNFVDFMD------SP 141 Halobacterium salinar...
O66674  68 L--------N--------EELKEYRSRVFKLAEATLrkeTlRELEGIIHSLEES-PGIEDVVIFEALSKEVVy----rEN 126 Aquifex aeolicus VF5
O66908  75 I--------Q--------EEIERYWGEVYRFIELLF---HtTGLHEILADELAIlPGMEEITSLLYVNKYYR------EG 129 Aquifex aeolicus VF5
Q55794  69 A--------L--------MELEGNWGAVKRYITQVL---QaRGLDGVQAEELAIlPGMDEIFGLVRMKRHYD------EA 123 Synechocystis sp. PCC...
Q46366  69 P--------Y--------VDLKQNWHSVQKYYTRIF---MaQGVSGVMADEMTIlPGMEELFSLLRIKRYKS------AG 123 Chlorobaculum tepidum...
Q12154  90 P--------SaalkdmndMAVSRANNNGSDGQGDDL---GsLLQGGALADLTGSiPGIDEALSFMEVMKHIKrqeqgeGE 158 Saccharomyces cerevis...
O43681 107 P--------Sl-------G-VAELPDEFFEEDN------MlSMGKKMMQEAMSAfPGIDEAMSYAEVMRLVK------GM 158 human
Q58542  96 P--------Qk------aMEEYKEKLKAQIEENPFL---G-EMLEDQLEMAALS-PGTDESAAFDVFLKYMD------SN 150 Methanocaldococcus ja...
O27555  82 P--------Ev------aMEEYQAKLQEQAAMNPGM---GlDMLQDQMDMASMS-PGIDEAAAFDQFLRYMT------TD 137 Methanothermobacter t...
P30632  88 S--------NpngegvemGNIEEMLQNAAQNEGGSG---GfSMGKDFLQSFAGGlPGIDEAMSFGEMIKLID------SL 150 Caenorhabditis elegans
3UG6_A  96 P--------Qk------aMEEYKEKLKAQIEENPFL---G-EMLEDQLEMAALS-PGTDESAAFDVFLKYMD------SN 150 Methanocaldococcus ja...
5BW8_A 109 PsaalkdmnD--------MAVSRANNNGSDGQGDDL---GsLLQGGALADLTGSiPGIDEALSFMEVMKHIKrqeqgeGE 177 Saccharomyces cerevis...
3ZQ6_A 138 EYDIVIFDTAPTGHTLRLLSFPEIMDSWVGkmikiRRqigsmaka--fknilpfMGDEE----Eed--rALQDMEATKKQ 209 Methanothermobacter t...
O52027 142 EYDVVVFDTAPTGHTIRLMELPSDWNAELE-----KG-----------------GSTCI----G-----PAASMDDKKAD 190 Halobacterium salinar...
O66674 127 EYDYIVVDTAPTGHTLGLLKTVRNLGNFLEeivklKEkvyel--------kklsGKSVH----Ee----ALEYLKERKER 190 Aquifex aeolicus VF5
O66908 130 NHDVLILDLPPTGESIRFVSMPTVMKWYMKkifktERlimkvar----ptvgrmTDVPL----Pde--eYFKALETFYER 199 Aquifex aeolicus VF5
Q55794 124 DYDVLIIDSAPTGTALRLLSLPEVGGWYMRrfykpLQgmsvalrplveplfrpiAGFSL----Pdk--eVMDAPYEFYEQ 197 Synechocystis sp. PCC...
Q46366 124 LYDALVLDTAPTGETLRLLSLPDTLSWGMKav-knVNkyivrplskplskmsdkIAYYI----Ppe--dAIESVDQVFDE 196 Chlorobaculum tepidum...
Q12154 159 TFDTVIFDTAPTGHTLRFLQLPNTLSKLLEkfgeiTNklgpml-----nsfmgaGNVDI----Sg----KLNELKANVET 225 Saccharomyces cerevis...
O43681 159 NFSVVVFDTAPTGHTLRLLNFPTIVERGLGrlmqiKNqispfisq--mcnmlglGDMNA----Dq----LASKLEETLPV 228 human
Q58542 151 EFDVVIFDTAPTGHTLRFLGMPEVMDKYMTkliklRKqmsgfmkm--mkkllpfGGKDE----DidydkMLEELEKMKER 224 Methanocaldococcus ja...
O27555 138 EYDIVIFDTAPTGHTLRLLSFPEIMDSWVGkmikiRRqigsmaka--fknilpfMGDEEee------drALQDMEATKKQ 209 Methanothermobacter t...
P30632 151 DFDVVVFDTAPTGHTLRLLQFPTLLEKVFTkilslQGmfgpmmnq--fggmfgmGGGSM----Ne----MIEKMTTTLES 220 Caenorhabditis elegans
3UG6_A 151 EFDVVIFDTAPTGHTLRFLGMPEVMDKYMTkliklRKqmsgfmkm--mkkllpfGGKDEdidyDk----MLEELEKMKER 224 Methanocaldococcus ja...
5BW8_A 178 TFDTVIFDTAPTGHTLRFLQLPNTLSKLLEkfgeiTNklgpml-----nsfmgaGNVDI----Sg----KLNELKANVET 244 Saccharomyces cerevis...
3ZQ6_A 210 INAAREVMSDPERTSFKMVVIPEEMSIYESERAMKALEKYSIHADGVIVNQ-VLPEE--S---DcEFCNARRKLQQERLK 283 Methanothermobacter t...
O52027 191 YERAIDTLSDESRTSFAFVGKPESSSIDEIERSASDLAELGISSQLLVVNG-YLPESvcE---D-PFFEGKRADEQAVID 265 Halobacterium salinar...
O66674 191 FKKFSEIIYDKSY--FFAVLTPEKLPFEETKRLVNSLKHYGIRVKALIINK-VLPENpqD-----EFLKARKEVEKKFLK 262 Aquifex aeolicus VF5
O66908 200 LKGVDEILINPDITSIRIVSNPEKMVLKESQRAFLYFLLFGVNVDAVIVNK-VIPEEviQq-eNcSFLEKWLNIQKKYVK 277 Aquifex aeolicus VF5
Q55794 198 IEALEKVLTDNTQTSVRLVTNPEKMVLKESLRAHAYLSLYNVSTDLVIANR-ILPETidD-----PFFQRWKSNQQVYKQ 271 Synechocystis sp. PCC...
Q46366 197 LEDIREILTDNVKSTVRLVMNAEKMSIKETMRALTYLNLYGFKVDMVLVNK-LLDAQenS-----GYLEKWKGIQQKYLG 270 Chlorobaculum tepidum...
Q12154 226 IR---QQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQlLFAENdqEh--NcKRCQARWKMQKKYLD 300 Saccharomyces cerevis...
O43681 229 IRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQlVFPDPe----kPcKMCEARHKIQAKYLD 304 human
Q58542 225 IVRARNILSDPERTAFRLVVIPEEMSILESERAMKALQKYGIPIDAVIVNQ-LIPEDvq-----cDFCRARRELQLKRLE 298 Methanocaldococcus ja...
O27555 210 INAAREVMSDPERTSFKMVVIPEEMSIYESERAMKALEKYSIHADGVIVNQ-VLPEEsd-----cEFCNARRKLQQERLK 283 Methanothermobacter t...
P30632 221 VKKMNAQFKDPNCTTFVCVCIAEFLSLYETERLIQELSKQGIDTHNIIVNQlLFPDTdaNgtvScRKCASRQAIQSKYLT 300 Caenorhabditis elegans
3UG6_A 225 IVRARNILSDPERTAFRLVVIPEEMSILESERAMKALQKYGIPIDAVIVNQ-LIPEDvq-----cDFCRARRELQLKRLE 298 Methanocaldococcus ja...
5BW8_A 245 I---RQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQlLFAENdqEh--NcKRCQARWKMQKKYLD 319 Saccharomyces cerevis...
3ZQ6_A 284 QIREKFSDKVVAEVPLLKKEAKGIETLEKIAEQLYG 319 Methanothermobacter thermautotrophicus str. Delta H
O52027 266 RVESTFDQQALATYPLQPGEIAGLELLSDVGGVLYD 301 Halobacterium salinarum NRC-1
O66674 263 EIENYFMDIEKISIPYQKEEVVGYEKLKEFSKFLPL 298 Aquifex aeolicus VF5
O66908 278 EIESYFSPVPVFKVPLLEEEVVGLERLEKLAQLIYG 313 Aquifex aeolicus VF5
Q55794 272 EIYDNFHPLPVKEAPLFSEEMCGLAALERLKDTLYK 307 Synechocystis sp. PCC 6803 substr. Kazusa
Q46366 271 EIEEGFSPLPVKKLKMYDQEIVGVKSLEVFAHDIYg 306 Chlorobaculum tepidum TLS
Q12154 301 QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNK 336 Saccharomyces cerevisiae S288C
O43681 305 QMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLE 340 human
Q58542 299 MIKEKFGDKVIAYVPLLRTEAKGIETLKQIAKILYG 334 Methanocaldococcus jannaschii DSM 2661
O27555 284 QIREKFSDKVVAEVPLLKKEAKGIETLEKIAEQLYG 319 Methanothermobacter thermautotrophicus str. Delta H
P30632 301 DIDELYEDFHVVKLPLLEAEVRGGPAILQFSERMVD 336 Caenorhabditis elegans
3UG6_A 299 MIKEKFGDKVIAYVPLLRTEAKGIETLKQIAKILYG 334 Methanocaldococcus jannaschii DSM 2661
5BW8_A 320 QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNK 355 Saccharomyces cerevisiae RM11-1a
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap