1KPI,1KPG,1TPY,3HA7


Conserved Protein Domain Family
CMAS

?
pfam02353: CMAS 
Click on image for an interactive view with Cn3D
Mycolic acid cyclopropane synthetase
This family consist of Cyclopropane-fatty-acyl-phospholipid synthase or CFA synthase EC:2.1.1.79 this enzyme catalyze the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid <=> S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
Statistics
?
PSSM-Id: 280508
View PSSM: pfam02353
Aligned: 12 rows
Threshold Bit Score: 402.09
Threshold Setting Gi: 81816293
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KPI_A  12 QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFER-------PDMtLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWG 84  Mycobacterium tubercu...
P0A9H7 108 SKKRAWIVGKEHYDLGNDLFSRMLDPFMQYSCAYWKD-------ADN-LESAQQAKLKMICEKLQLKPGMRVLDIGCGWG 179 Escherichia coli K-12
P9WPB1   3 KLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFER-------DDMtLEEAQLAKVDLALDKLNLEPGMTLLDVGCGWG 75  Mycobacterium tubercu...
1KPG_D   4 eLKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFER-------DDXtLQEAQIAKIDLALGKLGLQPGXTLLDVGCGWG 76  Mycobacterium tubercu...
1TPY_A   4 dLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFER-------EDMtLEEAQIAKIDLALGKLGLQPGMTLLDIGCGWG 76  Mycobacterium tubercu...
P0CH91  10 KSRSNVDDVQAHYDLSDAFFALFQDPTRTYSCAYFER-------DDMtLHEAQVAKLDLTLGKLGLEPGMTLLDVGCGWG 82  Mycobacterium tubercu...
3HA7_A  30 KTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEP-------PELtLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWG 102 Mycobacterium tubercu...
Q88C18 133 DKTTDAKAISYHYDVSNAFYQLWLDQDMAYSCAYFRE-------PDNtLDQAQQDKFDHLCRKLRLDAGDYLLDVGCGWG 205 Pseudomonas putida KT...
Q9CB74 131 SKTRDAEAIRHHYDVSNRFYEWVLGPSMTYTCAVYPN-------AEAtLEEAQENKYRLIFEKLRLQPGDRLLDVGCGWG 203 Mycobacterium leprae
O67624 106 RTIRDERNVKHHYDLGNDFYRLWLDKSMTYSCAFFED-------PSMsIDEAQSLKRRIIYEKLQLKEGDTLLDIGCGWG 178 Aquifex aeolicus
O25171 101 KPIKESSNISKHYDLGNDFYSIWLDETLSYSCAYFKK-------DDDtLHAAQLQKLDHTLKKLHLKPGEKLLDIGCGWG 173 Helicobacter pylori
O53732 141 SRDQARRNIAVHYDLSNDLFAAFLDETMTYSCAMFTDllaqptpAWTeLAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWG 220 Mycobacterium tubercu...
1KPI_A  85 STMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDsprrKEVRIQGWEEFDE---PVDRIVSLGAFEHFadgagdaGFER 161 Mycobacterium tubercu...
P0A9H7 180 GLAHYMASNYDVSVVGVTISAEQQKMAQERCEGLD----VTILLQDYRDLND---QFDRIVSVGMFEHV-------GPKN 245 Escherichia coli K-12
P9WPB1  76 GALVRAVEKYDVNVIGLTLSRNHYERSKDRLAAIGtqrrAEARLQGWEEFEE---NVDRIVSFEAFDAF-------KKER 145 Mycobacterium tubercu...
1KPG_D  77 ATXXRAVEKYDVNVVGLTLSKNQANHVQQLVANSEnlrsKRVLLAGWEQFDE---PVDRIVSIGAFEHF-------GHER 146 Mycobacterium tubercu...
1TPY_A  77 ATMRRAIAQYDVNVVGLTLSKNQAAHVQKSFDEMDtprdRRVLLAGWEQFNE---PVDRIVSIGAFEHF-------GHDR 146 Mycobacterium tubercu...
P0CH91  83 SVMKRAVERYDVNVVGLTLSKNQHAYCQQVLDKVDtnrsHRVLLSDWANFSE---PVDRIVTIEAIEHF-------GFER 152 Mycobacterium tubercu...
3HA7_A 103 TTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDtnrsRQVLLQGWEDFAE---PVDRIVSIEAFEHF-------GHEN 172 Mycobacterium tubercu...
Q88C18 206 GLARFAAREYGAKVFGITLSKEQLKLGRKRVQAEGladkVDLQILDYRDLPQd-gRFDKVVSVGMFEHV-------GHAN 277 Pseudomonas putida KT...
Q9CB74 204 GMVRYAARR-GVRVIGATLSAEQAKWARKAIDNEGlaeiAQVRYSDYRDIREt--EFDAVSSIGLTEHI-------GVKN 273 Mycobacterium leprae
O67624 179 SIILESAELYNVKSVGITLSDNQYEYVKEEIKKRGlqdkVEVYKLHYVDLPKlgrKFNKVVSVGMFEHV-------GKEN 251 Aquifex aeolicus
O25171 174 YLSVKAAQEYGAEVMGITISSEQYKQANKRVQELGledkVTIKLLNYQDLDGrlyRFDKVVSVGMFEHV-------GKDN 246 Helicobacter pylori
O53732 221 ELCIRAAAR-GAHIRSVTLSVEQQRLARQRVAAAGfghrVEIDLCDYRDVDG---QYDSVVSVEMIEAV-------GYRS 289 Mycobacterium tubercu...
1KPI_A 162 YDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQelglTspmsllrfiKFILTEIFPGGRLPRISQVDYy-SSNAGWKVERY 240 Mycobacterium tubercu...
P0A9H7 246 YDTYFAVVDRNLKPEGIFLLHTIGSKKTDLNV----D---------PWINKYIFPNGCLPSVRQIAQ--SSEPHFVMEDW 310 Escherichia coli K-12
P9WPB1 146 YLTFFERSYDILPDDGRMLLHSLFTYDRRWLHeqgiAltmsdlrflKFLRESIFPGGELPSEPDIVDn-AQAAGFTIEHV 224 Mycobacterium tubercu...
1KPG_D 147 YDAFFSLAHRLLPADGVXLLHTITGLHPKEIHerglPxsftfarflKFIVTEIFPGGRLPSIPXVQEc-ASANGFTVTRV 225 Mycobacterium tubercu...
1TPY_A 147 HADFFARAHKILPPDGVLLLHTITGLTRQQMVdhglPltlwlarflKFIATEIFPGGQPPTIEMVEEq-SAKTGFTLTRR 225 Mycobacterium tubercu...
P0CH91 153 YDDFFKFAYNAMPADGVMLLHSITGLHVKQVIergiPltmemakfiRFIVTDIFPGGRLPTIETIEEh-VTKAGFTITDI 231 Mycobacterium tubercu...
3HA7_A 173 YDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAargkKlsfetarfiKFIVTEIFPGGRLPSTEMMVEh-GEKAGFTVPEP 251 Mycobacterium tubercu...
Q88C18 278 LALYCQKLFGAVREGGLVMNHGITAKHVDGRPvgrgAg--------EFIDRYVFPHGELPHLSMISAs-ICEAGLEVVDV 348 Pseudomonas putida KT...
Q9CB74 274 YPAYFNFLKLKLRTGGLLLNHCITRRDNKSTSfa-----------gGFTDRYVFPDGELTGSGRITTe-IQEVGLEVLHE 341 Mycobacterium leprae
O67624 252 YETFFNTVYKVMEEGGLFLLHTIGKLHPDTQS--------------RWIRKYIFPGGYLPSISEIVEs-FRDMDFTLIDF 316 Aquifex aeolicus
O25171 247 LPFYFKKVKEVLKRGGMFLLHSILCCFEGKTN--------------AWVDKYIFPGGYLPSLREVMSv-MSECDFHLLMA 311 Helicobacter pylori
O53732 290 WPRYFAALEQLVRPGGPVAIQAITMPHHRMLAtrhtQ---------TWIQKYIFPGGLLPSTQAIIDitGQHTGLRIVDA 360 Mycobacterium tubercu...
1KPI_A 241 HRIGANYVPTLNAWADALQAHKDEAIAL-KGQETCDIYMHYLRGCSDLFRDKYTDVCQF 298 Mycobacterium tuberculosis
P0A9H7 311 HNFGADYDTTLMAWYERFLAAWPEIADN-YSERFKRMFTYYLNACAGAFRARDIQLWQV 368 Escherichia coli K-12
P9WPB1 225 QLLQQHYARTLDAWAANLQAARERAIAV-QSEEVYNNFMHYLTGCAERFRRGLINVAQF 282 Mycobacterium tuberculosis H37Rv
1KPG_D 226 QSLQPHYAKTLDLWSAALQANKGQAIAL-QSEEVYERYXKYLTGCAEXFRIGYIDVNQF 283 Mycobacterium tuberculosis
1TPY_A 226 QSLQPHYARTLDLWAEALQEHKSEAIAI-QSEEVYERYMKYLTGCAKLFRVGYIDVNQF 283 Mycobacterium tuberculosis
P0CH91 232 QSLQPHFARTLDLWAEALQAHKDEAIEI-QSAEVYERYMKYLTGCAKAFRMGYIDCNQF 289 Mycobacterium tuberculosis H37Rv
3HA7_A 252 LSLRPHYIKTLRIWGDTLQSNKDKAIEV-TSEEVYNRYMKYLRGCEHYFTDEMLDCSlv 309 Mycobacterium tuberculosis H37Rv
Q88C18 349 ESLRLHYAKTLHHWSENLENQLHKAAAL-VPEKTLRIWRLYLAGCAYAFQKGWINLHQI 406 Pseudomonas putida KT2440
Q9CB74 342 ENFRHHYAMTLRDWCHNLVEHWEDAVAE-VGLPIAKVWGLYMAASRVAFEQNNLQLHHI 399 Mycobacterium leprae
O67624 317 DNWRMHYYWTLKKWKERFYENLDKIRNM-FDDRFIRMWELYLTASAVSFLIGSNYVFQI 374 Aquifex aeolicus
O25171 312 ESLRIHYAKTLDIWRNNFNHNLDQVKRLsYDERFIRMWDLYLRTCASAFRVGSADLFQL 370 Helicobacter pylori
O53732 361 ASLRPHYAETLRLWRERFMQRRDGLAHLgFDEVFARMWELYLAYSEAGFRSGYLDVYQW 419 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap