Conserved Protein Domain Family
TFIID-18kDa

?
pfam02269: TFIID-18kDa 
Transcription initiation factor IID, 18kD subunit
This family includes the Spt3 yeast transcription factors and the 18kD subunit from human transcription initiation factor IID (TFIID-18). Determination of the crystal structure reveals an atypical histone fold
Statistics
?
Aligned: 6 rows
Threshold Bit Score: 122.152
Threshold Setting Gi: 74962569
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P11747   9 NLFNKDVSSLLYAYGDVPQPLQATVQCLDELVSGYLVDVCTNAFHTAQNSqrnKLRLEDFKFALRKDPIKLGRAEELIAT 88  Saccharomyces cerevis...
Q17957  27 HVLRRDLRSMVYGFGDDKEPYDKTLDTLEAIVLNYIKELCQLAMKVGKPD---KMALEDIHYLIRRDPKKFSRVKDLLSM 103 Caenorhabditis elegans
Q15543  30 RLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQG---RVQVEDIVFLIRKDPRKFARVKDLLTM 106 human
O75486  24 ISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRgarVITPEDLLFLMRKDKKKLRRLLKYMFI 103 human
P06844   5 HKYRVEIQQMMFVSGEINDPPVETTSLIEDIVRGQVIEILLQSNKTAHLRgsrSILPEDVIFLIRHDKAKVNRLRTYLSW 84  Saccharomyces cerevis...
O14311   8 SKYRVEIQQMMFILGEVQDPLPETTQLVEELIRGQVMEMLIQANELALRRgsrSITVEDLFFLIRHDRAKVNRLKTYLSW 87  Schizosaccharomyces p...
P11747  89 NKLITEAKKQFNE 101 Saccharomyces cerevisiae S288C
Q17957 104 SEELKKARKQFED 116 Caenorhabditis elegans
Q15543 107 NEELKRARKAFDE 119 human
O75486 104 RDYKSKIVKGIDE 116 human
P06844  85 KDLR-KNAKDQDA 96  Saccharomyces cerevisiae S288C
O14311  88 KEVR-KKAKEQDA 99  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap