5YZ0,6HKA,5OJS


Conserved Protein Domain Family
FATC

?
pfam02260: FATC 
Click on image for an interactive view with Cn3D
FATC domain
The FATC domain is named after FRAP, ATM, TRRAP C-terminal. The solution structure of the FATC domain suggests it plays a role in redox-dependent structural and cellular stability.
Statistics
?
Aligned: 351 rows
Threshold Bit Score: 36.2019
Threshold Setting Gi: 443898461
Created: 3-Jun-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YZ0_A              2613 PLSIEGHVHYLIQEATDENLLCQMYLGWTPY 2643 human
EFW22703            3713 NLPANQSAIDLISKAVNPQSLAQCEALWMPY 3743 Coccidioides posadasii str. Silveira
ERS99095            4126 NLPAYQTVIDLIAKATNPVNLAMCDVLWMAF 4156 Sporothrix schenckii ATCC 58251
EHY54471            3769 vLPACQNVVDLVSRATDPMKLSAMDGLWMPW 3799 Exophiala dermatitidis NIH/UT8656
XP_016760108        2165 NLPASQSVLDLVARATNPEKLAQTDLLWMPW 2195 Sphaerulina musiva SO2202
Q0UBC8              3766 NLPANQTVVDLVAVAVDPKKLASMDPLWMGY 3796 Parastagonospora nodorum SN15
Q6CDB3              3778 nVPANQTVIDLISQAVNPRYLALTDNLWQAY 3808 Yarrowia lipolytica
EPY52670            3630 NLPITQTLIDLISQATNPKQLAQMDQLWQAW 3660 Schizosaccharomyces cryophilus OY26
WGS:AATM:SJAG_04613 3606 NLPANQTILDYISQAVNPKALAQMDVLWAPW 3636 Schizosaccharomyces japonicus yFS275
Q9HFE8              3668 NLPVNQTAIDYLAQASSSKVLAQMDVLWAPW 3698 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap