2KYG,3TNP


Conserved Protein Domain Family
RIIa

?
pfam02197: RIIa 
Click on image for an interactive view with Cn3D
Regulatory subunit of type II PKA R-subunit
Statistics
?
PSSM-Id: 334843
View PSSM: pfam02197
Aligned: 14 rows
Threshold Bit Score: 53.1021
Threshold Setting Gi: 12644234
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*....
2KYG_A        13 PGLTELLQGYTVEVLRQQPPDLVEFAVEYF-TRLREARA 50
gi 12644234    1 MSFEEVYEELKALVDEQNPSDVLQFCYDFFgEKLKAERS 39
gi 119364599   5 SSYTALLNDLNRDVARARPADALQFCANWFnSKLEEQRR 43
gi 97536543   20 HNIQQLVKEAIVVLCIHKPDNPVLFLKDHF-EKLNEQRA 57
gi 6225584     7 EGLTDLLQDFTVAVLREKPSDLVEFASSYF-AKLQENNI 44
gi 124053463  12 YGLKTLLEGISRAVLKTNPSNINQFAAAYF-QELTMYRG 49
gi 74964402   11 HDLRPILEALAREVLRSQPSDVAEFGHMFF-DEYLKHRR 48
gi 125222      7 KESQAELQLFQNEINAANPSDFLQFSANYFnKRLEQQRA 45
3TNP_B         7 aGLTELLQGFTVEVLRHQPADLLEFALQHF-TRLQQENE 44
gi 982899776 481 QGFGNLLEGLTREILREQPDNIPAFAAAYF-ESLLEKRE 518
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap