2Z6E,3O4X,1Y64


Conserved Protein Domain Family
FH2

?
pfam02181: FH2 
Click on image for an interactive view with Cn3D
Formin Homology 2 Domain
Statistics
?
PSSM-Id: 366959
View PSSM: pfam02181
Aligned: 44 rows
Threshold Bit Score: 261.432
Threshold Setting Gi: 74963826
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Z6E_A    7 KKSIPQPTNALKSFNWSKLPENKLEGT-VWTEIDDTKVFK---------ILDLEDLERTFSAYqrqqdffvnsnSKQKEA 76   human
O60879  628 QKKMYKPEVSMKRINWSKIEPTELSENcFWLRVKEDKFEN---------PDLFAKLALNFATQ-----------IKVQKN 687  human
Q9Z207  615 pKKEFKPEISMRRLNWLKIGPNEMSENcFWIKVNENKYEN---------RDLLCKLENTFCCQ-----------EKEKRN 674  house mouse
Q0QWG9  812 HRRSETSHMSVKRLRWEQVENSEGT---IWGQLGEDSDYDkl-----sdMVKYLDLELHFGTQ-----------KPPKPV 872  house mouse
O94532  845 LRDLHKPTRPLKRVHWQRVDPLPG-------------------------PNVFTKFCLNFDIT-----------AKVFID 888  Schizosaccharomyces...
Q10719  868 PGELCNPSKRLKQLHWKRLEVPFEKT--LWNIVVADPYLLtlk---ltaEGIFKQLEDCYPLR-----------EVT--- 928  Schizosaccharomyces...
Q10059  980 TGLTRRPTRRLKQMHWEKLNSGLEFT--FWTGPSDEANKIlet---lhtSGVLDELDESFAMK-----------EAK--- 1040 Schizosaccharomyces...
P78621 1141 VMSSIRPKKKLKALHWDKVDTPQVT---VWATHGTTPQEKeekyvelakRGVLDEVERLFMAK-----------ETRIFG 1206 Aspergillus nidulan...
P41832 1348 FEKYPRPHKKLKQLHWEKLDCTDNS---IWGTGKAEKFADdl-----yeKGVLADLEKAFAAR-----------EIKSLA 1408 Saccharomyces cerev...
3O4X_E   19 PKKVYKPEVQLRRPNWSKFVAEDLSQDcFWTKVKEDRFEN---------NELFAKLTLAFSAQ-----------TKTSKA 78   house mouse
2Z6E_A   77 DAi-------------DDTLSSKLKVKELSVIDGRRAQNCNILLSRL-KLSNDEIKRAILTMDEqedLP----------- 131  human
O60879  688 AEal----------eeKKTGPTKKKVKELRILDPKTAQNLSIFLGSY-RMPYEDIRNVILEVNEd-mLS----------- 744  human
Q9Z207  675 TNd------------fDEKKVIKKRMKELKFLDPKIAQNLSIFLSSF-RVPYEKIRTMILEVDEt-qLS----------- 729  house mouse
Q0QWG9  873 PG-----------------PEPFRKKEVVEILSHKKAYNTSILLAHL-KLTPGELRQVLMSMEPr-rLE----------- 922  house mouse
O94532  889 NGlldfldekfdntprEDFVAVEISDQRSSLLPDTVEQNMAIILRSVsNMPVEDLVQKFLv-----ePDflpasilyfdr 963  Schizosaccharomyces...
Q10719  929 -------------------VSNKKVKEYTGFMPVDLQQMVSIRLHRFnSLTPIEIAKKFFHCDHd-iMElvdffndrkff 988  Schizosaccharomyces...
Q10059 1041 -------------------TLVKKTCARTDYMSSELQKLFGIHFHKLsHKNPNEIIRMILHCDDs--------------- 1086 Schizosaccharomyces...
P78621 1207 GG-----------------VAAKQRKDKKQIISNDLSKNFQIALSKFsQFPAEEVVRRIIHCDAe-iLDnmvvmeflqrd 1268 Aspergillus nidulan...
P41832 1409 -------------------SKRKEDLQKITFLSRDISQQFGINLHMYsSLSVADLVKKILNCDRd-fLQtpsvveflsks 1468 Saccharomyces cerev...
3O4X_E   79 KKdqe--------ggeEKKSVQKKKVKELKVLDSKTAQNLSIFLGSF-RMPYQEIKNVILEVNEa-vLT----------- 137  house mouse
2Z6E_A  132 --KDMLEQLL-KFVPEKSDIDLL--E--------EHKHEl------dRMAKAD-RFLFEMSR-INHYQQRLQSLYFKKKF 190  human
O60879  745 --EALIQNLV-KHLPEQKILNEL--A--------ELKNEy------dDLCEPE-QFGVVMSS-VKMLQPRLSSILFKLTF 803  human
Q9Z207  730 --ESMIQNLI-KHLPDEEQLKSL--S--------QFRSDy------nSLCEPE-QFAVVMSN-VKRLRPRLSAILFKLQF 788  house mouse
Q0QWG9  923 --PAHLAQLL-LFAPDADEEQRY--Q--------AFREAp------gRLSEPD-QFVLQMLS-VPEYKTRLRSLHFQATL 981  house mouse
O94532  964 asLASTNAYTdPFIPYSTDYTKKnpK--------EPTADv------nSLSYFEkFFVLFVVNlRHYFQERMKALKFRSTL 1029 Schizosaccharomyces...
Q10719  989 rqEGLKKQLKpYMSSRNEEVMEVseKl-------------------lELSRFDqIYTLIVVDiDTYYEKRMAALKIKSFL 1049 Schizosaccharomyces...
Q10059 1087 -mNECVEFLSsDKVLNQPKLKADlePyridwangGDLVNsek--dasELSRWDyLYVRLIVDlGGYWNQRMNALKVKNII 1163 Schizosaccharomyces...
P78621 1269 emCTVPENVSkLMAPYSKDWTGPdaA----------NTEreq--dpsELTREDqIYLYTAFElNHYWKARMRALALTRSF 1336 Aspergillus nidulan...
P41832 1469 eiIEVSVNLArNYAPYSTDWEGV--R--------NLEDAkppekdpnDLQRADqIYLQLMVNlESYWGSRMRALTVVTSY 1538 Saccharomyces cerev...
3O4X_E  138 --ESMIQNLI-KQMPEPEQLKML--S--------ELKEEy------dDLAESE-QFGVVMGT-VPRLRPRLNAILFKLQF 196  house mouse
2Z6E_A  191 AERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQR--GNAYGFKISSLNKIADTKSSiDKNITLLHYLI 268  human
O60879  804 EEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRn-AQSLGFKINFLCKIRDTKSA-DQKTTLLHFIA 881  human
Q9Z207  789 EEQVNNIKPDIMAVSTACEEIKKSKGFSKLLELVLLMGNYMNAGSRn-AQTFGFDLSSLCKLKDTKSA-DQKTTLLHFLV 866  house mouse
Q0QWG9  982 QEKTEEIRGSLECLRQASLELKNSRKLAKILEFVLAMGNYLNDGQPktNKTTGFKINFLTELNSTKTV-DGKSTFLHILA 1060 house mouse
O94532 1030 FGDLEILEVRMKEVIDTSDSIMEDKNFAEFFQVLLIIGNYFNEPY---DRASAFSLYMIYRLETLRDS-SSALTLMHYFD 1105 Schizosaccharomyces...
Q10719 1050 ANNFRDFRRQIRKLHCASLELKSSLHFKYFLNLVLHIGNFMNDAP---RRAKGYRLESLLRASMIKND-KTGLTLLHTIE 1125 Schizosaccharomyces...
Q10059 1164 ETNYENLVRQTKLIGRAALELRDSKVFKGLLYLILYLGNYMNDYV---RQAKGFAIGSLQRLPLIKNA-NNTKSLLHILD 1239 Schizosaccharomyces...
P78621 1337 EPDYEHISAKLREVVRVSESLRDSVSLMNVLGLILDIGNFMNDAN---KQAQGFKLSSLARLGMVKDD-KNETTFADLVE 1412 Aspergillus nidulan...
P41832 1539 EREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTS---KQAQGFKLSTLQRLTFIKDT-TNSMTFLNYVE 1614 Saccharomyces cerev...
3O4X_E  197 SEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRn-AGAFGFNISFLCKLRDTKSA-DQKMTLLHFLA 274  house mouse
2Z6E_A  269 TIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKsQ-----PPQPGDKFVSVVSQFITVAS 343  human
O60879  882 DICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFP-Q-----AENQHDKFVEKMTSFTKTAR 955  human
Q9Z207  867 DVCEEKHADILHFVDDLAHLDKASRVSVEMLEKNVKQMGRQLQQLEKNLETFP-P-----PEDLHDKFVIKMSSFVISAN 940  house mouse
Q0QWG9 1061 KSLSQHFPELLGFAQDLPTVPLAAKVNQRALTGDLADLHDTVSEIQVACQSMA-P-------SSEDRFAVVMASFLETAQ 1132 house mouse
O94532 1106 EIIRTRFPELLQAESTFKKIQSVSGYNIDAMVAGVDGAYDEFCDFQTSLKDGA-Lsk-cdQHHPDDKAYDILSEWLPEAK 1183 Schizosaccharomyces...
Q10719 1126 KIVRTHFPQLEAFLVDLKAIPEISRFNLEQLEQDCNDICERMKNVEKDFSNEG-IfsnhkALHPDDHICEVMVPWIPSGK 1204 Schizosaccharomyces...
Q10059 1240 ITIRKHFPQFDNFSPELSTVTEAAKLNIEAIEQECSELIRGCQNLQIDCDSGA-Lsd-ptVFHPDDKILSVILPWLMEGT 1317 Schizosaccharomyces...
P78621 1413 RIVRNQYPEWEDFTEQISGVIGLQKLNVDQLRTDAKKYIDNIKNVQASLDAGN-Lsd-pkKFHPQDRVSQITQRSMKDAR 1490 Aspergillus nidulan...
P41832 1615 KIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGN-Lsd-ssKFHPLDKVLIKTLPVLPEAR 1692 Saccharomyces cerev...
3O4X_E  275 ELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFP-A-----ATDEKDKFVEKMTSFVKDAQ 348  house mouse
2Z6E_A  344 FSFSDVEDLLAEAKDLFTKAVKHF---GEEAg-KIQPDEFFGIFDQFLQAVS 391  human
O60879  956 EQYEKLSTMHNNMMKLYENLGEYF---IFDSk-TVSIEEFFGDLNNFRTLFL 1003 human
Q9Z207  941 EQYEKLSTLLGSMTQLYQSIMGYY---AVDMk-KVSVEEFFNDLNNFRTSFm 988  house mouse
Q0QWG9 1133 PALRALDGLQREAMEELGKALAFF---GEDSk-ATTSEAFFGIFSEFMSKFE 1180 house mouse
O94532 1184 ERIRNIKKLKTDMLTKLENTVKYLceyDSIDk---VRNSFFKNLNSFYEMYS 1232 Schizosaccharomyces pombe 972h-
Q10719 1205 SMVDELNSDITELKTTLKTTLLMY---GENPdePTSSARFFNNLNEIILEYK 1253 Schizosaccharomyces pombe 972h-
Q10059 1318 KKMDFLKEHLRTMNTTLNNAMRYF---GEQPndPNSKNLFFKRVDSFIIDYS 1366 Schizosaccharomyces pombe 972h-
P78621 1491 RKAEQMQLYLEEMVKTYDDIMVFY---GEDNtdDGARRDFFAKLAAFLQEWK 1539 Aspergillus nidulans FGSC A4
P41832 1693 KKGDLLEDEVKLTIMEFESLMHTY---GEDSgdKFAKISFFKKFADFINEYK 1741 Saccharomyces cerevisiae S288C
3O4X_E  349 EQYNKLRMMHSNMETLYKELGDYF---VFDPk-KLSVEEFFMDLHNFRNMFl 396  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap