1V5S


Conserved Protein Domain Family
KA1

?
pfam02149: KA1 
Click on image for an interactive view with Cn3D
Kinase associated domain 1
Statistics
?
Aligned: 97 rows
Threshold Bit Score: 44.3953
Threshold Setting Gi: 1516539578
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V5S_A          76 NLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELK 119  house mouse
EGC29180       819 EGVRFSIEVCRLPRLSVNGLKFKRIGGSSWRYKSICKDLLSQMK 862  Dictyostelium purpureum
16_pfamImport    1 AGVQIELEVCEGPCPSYKGLKMRRISGDNSKYSQLCQELITCM- 43  
XP_004348158  1428 KPSQFELEVCHIPRLSLYGLHVKRIRGDIWRHKRVCSTLIASMN 1471 Capsaspora owczarzaki ATCC 30864
ESN99549       605 SHVEWVMEVCRLPRLSVNGIKFKRISGSPLIYKNIAAKISNELK 648  Helobdella robusta
CDS37047      1436 EILRLELEVCKLPKEGMNGVRFKRLAGPAAEFKRISQKLAEDLK 1479 Echinococcus multilocularis
GAA57025      1194 giVHWEMEVGKLAGVGMNGIRFKRINGSMSAFKQIAKKLAADLK 1237 Clonorchis sinensis
XP_018644644   987 gVVHWEMEICKLNRAGANGIRFKRISGSTSDFKRLANKLASDLE 1030 Schistosoma mansoni
EDQ84930       595 gdIVFEMEVCKLPRLLMNGIRHKRISGSSLDYKNICTKVLNETQ 638  Monosiga brevicollis MX1
XP_004363915   804 EGVQWEMEVCKLPRLSLHGIRIKRISGNSLTYKNVCAKVIDKMK 847  Capsaspora owczarzaki ATCC 30864
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap