4F38


Conserved Protein Domain Family
Rho_GDI

?
pfam02115: Rho_GDI 
Click on image for an interactive view with Cn3D
RHO protein GDP dissociation inhibitor
Statistics
?
PSSM-Id: 366924
View PSSM: pfam02115
Aligned: 40 rows
Threshold Bit Score: 219.429
Threshold Setting Gi: 340960640
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4F38_B               11 LAQIAAENEEDEHsvnYKPPAQKSIQEIQELDKDDESLRKYKEAL-LGRvaV---SaDPNVPN-VVVTRLTLVCSTAP-G 84  house mouse
EPY50910             10 NGTNELDDEFVDNsvpVSLGEKKTLNEYVHMDAEDPSLTKWKESLgISNkgYs----PPNDPRtVVIEQLSLLVNGR--D 83  Schizosa...
GAC77213             61 DPTIADEELATTAtagYKVGEKKSLAEYSQLDAEDESLARWKASLgIGAstG---AvDPNAPK-LSLHALSLVSSSAPgG 136 Moesziom...
CBY07012             10 LKALAIKEEEEESk--YKAPAEKSIEELQKLDESDEALKRYKEQL-LGNleS---AkSADARR-VVVKKILLNSKDLP-S 81  Oikopleu...
13_pfamImport         1 EQVVDQVKEEEEEissYKPPPEKSLQDILAADENDESLRKYKETL-LGNatTetiIiVPDDPR-KVLVQKLVLVAAGR-T 77 
WGS:AAQB:GK16712-PC   8 QHHADDHHDEDVHdanYQAPPEKTIEEIMAADQEDESLRRYKEAL-LGAaqAekiIvEPNDPR-KVIVKKLALVVEGR-D 84  Drosophi...
ELV10122              7 eAHLEEDDDELDEklnYKPPPQKSLKELQEMDKDDESLAKYKKTL-LGDgpV---VaDPSVPN-VVVTRLTLVCDSAP-G 80  Chinese ...
5_pfamImport          1 LEELAAANREGENavnYKPPAQKSLQEIQQLDEQDESLRKYKEAL-LGKvaT---VaDPSVPN-VQVMRMTLVCDSAP-Q 74 
XP_003964507         11 LAEIAAANEESEGsvnYKAPAQKSLQEIQELDKDDDSLRRYKEAL-LGKasV---VtDPKLPN-VHVTRMTLMCDTAP-G 84  torafugu
XP_005807076         11 LKEIAVANEEKESdinYKPPAQKSLQEIQELDKDDESLRKYKEAL-LGKaaV---VaDPTAPN-VQVTRMTLMCENAP-A 84  southern...
4F38_B               85 PLELDLTGd---LESfkKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRA-EEYEFLT 160 house mouse
EPY50910             84 PIHVDMQDeg-sVEQiqKKGFVIKEDSEYRIAVRFRVQHELISGLRYVQVVRRVGMTVDKSSTMIGSYSPNE-TPYEFTT 161 Schizosa...
GAC77213            137 SVSINLQQskeqLAQfkQNPLNVKEGVEYSVKIRFSVGSDILSGLKYVQVVKRAGIKVDKMEEMIGSYGPRA-EPYEKTF 215 Moesziom...
CBY07012             82 PLIMDLS------DTskKQSFKIKEGAEYTIGIEFKVNNEIVSGLRYNQVVTRKGIKVDKMNLMVGSYAPRA-DDYTFTT 154 Oikopleu...
13_pfamImport        78 DIELDLTGd---LTQlkKQEFKIKEGVQYRIRIDFLVQREIVTGLKYVQKTYRKGIQVDKMAHMVGSYAPKQ-EIQSYLT 153
WGS:AAQB:GK16712-PC  85 DMELDLTGd---ISQlkQQVFVIKEGVQYKVRIDFIVQREIVHGLKYVQKTYRMSLPVDKMAHMVGSYPPKK-EIQNYLT 160 Drosophi...
ELV10122             81 PITMDLTGd---IEAlkKELFVLKEGVEYRVKINFKVNRDIVSGLKYVQHTYRTGLKVDKATFMVGSYGPRS-EEYEFLT 156 Chinese ...
5_pfamImport         75 PLVLNLQd----LDKlkKNPFVMKEGIEYRIKITFKVNKDIVSGLKYTQQTFRKGIKLDKSDYMVGSYGPKAdEEYEFLT 150
XP_003964507         85 ALVLDLTGn---LENikKSTFVLKEGVDYKIKITFKVNKEIVSGLRYTQTSTRKGVKVDKTDYMVGSYGPRPeEEYEYVT 161 torafugu
XP_005807076         85 PLVLDLQGd---LESfkKHPFTLKEGVEYRIKINFKVNKEIVSGLRYNQQTFRKGVKVDKSDYMVGSYGPRPdEEYEFLT 161 southern...
4F38_B              161 PMEEAPKGMLARGSYNIKSRFTDDDRTDHLSWEWNLTIKKE 201 house mouse
EPY50910            162 EPEEAPSGFLARGHYEAIGKFIDDDQVVHHVVQWSFDVTKn 202 Schizosaccharomyces cryophilus OY26
GAC77213            216 ASSEAPSGMMARGNYSVRSRVVDDDNNVFADWEWAFKIAKD 256 Moesziomyces antarcticus T-34
CBY07012            155 ELDEAPSGMLARGSYKVQSKFIDDDKTEHAVWEWQFDIAKK 195 Oikopleura dioica
13_pfamImport       154 PLEDAPSGLLARGGYSVKSCFTDDDNTEHLKWEWAFEIKKE 194
WGS:AAQB:GK16712-PC 161 PPEEAPSGMISRGTYSVSSVFTDDDKHIHLKWDWTFEIKKD 201 Drosophila willistoni
ELV10122            157 PTEEAPKGMLARGTYHNKSFFTDDDKHDHLTWEWNLSIKKD 197 Chinese tree shrew
5_pfamImport        151 TVEESPKGLLARGTYNIKSKFTDDDEHDHLSWEWSLTIKKD 191
XP_003964507        162 PVEEAPKGMLARGTYTIKSKFTDDDKHDHLSWEWNLTIKKD 202 torafugu
XP_005807076        162 TLEEAPKGMLARGTYNIKSKFTDDDKYDHLSWEWSLAIKKD 202 southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap