Conserved Protein Domain Family
HK

?
pfam02110: HK 
Hydroxyethylthiazole kinase family
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 340.899
Threshold Setting Gi: 732340
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P40386 246 LQKLKDFTPLIHHLTNAVAKNFSANVTLAAYGSPTMGESYDEVADFAKAPGA-LVLNIGILEN--TKTYIHAAQVNNDLA 322 Schizosaccharomyces p...
P41835 255 ISQVSNNRPLVQHITNKVHQNFGANVTLALGSSPIMSEIESEVSELARIPNAsLLLNTGSVAP--IEMLKAAINAYNEVN 332 Saccharomyces cerevis...
O28204  14 IARIAEFKPVVHHITNYVAMNDSANITIAIGASPIMSFAHGEIDELVSIASS-LLINIGTLDEyiIQAVMLAVKSAKSKG 92  Archaeoglobus fulgidu...
P39593  10 LTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGA-LVLNIGTLSKesVEAMIIAGKSANEHG 88  Bacillus subtilis sub...
Q57233   8 LSKIREQNPLIHNITNIVAANFSANGLLALGASPLMSANVEEMQEVPKISQA-LVINIGTLIGkdREAMLQAGKTANEVG 86  Haemophilus influenza...
O25516   2 LKELRQKRPLVHNITNYVAAQFVANGLLALGASPLMSDAIDEMRDLAKISDA-LAINIGTLNDraILCAKEAIKHYKALN 80  Helicobacter pylori 2...
P55883  15 LKHFRALSPLTHCMTNDVVQTFTANTLLALGASPAMVIDPVEARPFAAIANA-LLINVGTLTAsrADAMRAAVESAYDAK 93  Salmonella enterica s...
P76423  15 LHLFHQHSPLVHCMTNDVVQTFTANTLLALGASPAMVIETEEASQFAAIASA-LLINVGTLTQprAQAMRAAVEQAKSSQ 93  Escherichia coli K-12
P40386 323 RPVILDPVAVGATTARSKVINTLLNYAYYDIIKGNEGEIMNLAGEQ-GLMRGVDSISQHTLa-ArITAVHRLAVERRCVV 400 Schizosaccharomyces p...
P41835 333 RPITFDPVGYSATETRLCLNNTLLTYGQFACIKGNCSEILSLAKLNnHKMKGVDSSSGKTNidTlVRATQIVAFQYRTVA 412 Saccharomyces cerevis...
O28204  93 VPVLLDPVGSGATKLRTSTALSVA-EEGVDVIKGNQGEILSLLRKE-GVVRGVDSKVTAEA-----ADVKEVARKFGLVV 165 Archaeoglobus fulgidu...
P39593  89 VPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAEIAHTVGVTdWLIKGVDAGEGGGD--I-IRLAQQAAQKLNTVI 165 Bacillus subtilis sub...
Q57233  87 IPVVLDPVGVGATSYRRETIRELLAEVKFALIRGNAGELAAIAGET-WQAKGVDAGQGEVD--L-KAVAEKVAQRYGCTV 162 Haemophilus influenza...
O25516  81 KPIVLDPVGCSASALRHDTSLELLKSGGISALRGNAAELGSLVGIS-CESKGLDSNDAAT---P-VEIIKLAAQKYSVIA 155 Helicobacter pylori 2...
P55883  94 TPWTLDPVAVGALEFRRRFCLDLL-SLRPAAIRGNASEILALSGMA-LGGRGVDTTEAALA--A-LPAAQALARQIDCIV 168 Salmonella enterica s...
P76423  94 TPWTLDPVAVGALDYRRHFCHELL-SFKPAAIRGNASEIMALAGIA-NGGRGVDTTDAAAN--A-IPAAQTLARETGAIV 168 Escherichia coli K-12
P40386 401 AMSGAVDVISDGNS--TYVIKNGNP------------------LLGQITASGCSLGSVMGVTASIC--QNDKLLAaITAT 458 Schizosaccharomyces p...
P41835 413 VCTGEFDCVADGTFggEYKLSSGTEgitaedlpcviiedgpipIMGDITASGCSLGSTIASFIGGLdsTGKLFDAvVGAV 492 Saccharomyces cerevis...
O28204 166 VATGKEDLISDGRS--VYVMRNGTE------------------MLGRITASGCMLGSVIASFMAVQ--KDFLLAS-LEGL 222 Archaeoglobus fulgidu...
P39593 166 AITGEVDVIADTSH--VYTLHNGHK------------------LLTKVTGAGCLLTSVVGAFCAVE--ENPLFAA-IAAI 222 Bacillus subtilis sub...
Q57233 163 LISGAVDIVSDGTQ--TATVHNGTS------------------LFPKVTASGCLLSAVCAAFLAVS--EGNYFSAtLEAC 220 Haemophilus influenza...
O25516 156 VMTGKTDYVSDGKK--VLSITGGSE------------------YLALITGAGCLHAAACASFLSLK--KDPLDSM-AQLC 212 Helicobacter pylori 2...
P55883 169 VVTGEIDYVTNGQR--TLSIPGGDP------------------LMTRIVGTGCALSAVVAASCALP--GAALDNV-ASAC 225 Salmonella enterica s...
P76423 169 VVTGEMDYVTDGHR--IIGIHGGDP------------------LMTKVVGTGCALSAVVAACCALP--GDTLENV-ASAC 225 Escherichia coli K-12
P40386 459 LLYNIASelaVEAKNSCGDLlvqgpGTFIPIFVDKLHQLINE 500 Schizosaccharomyces pombe 972h-
P41835 493 LLYKSAG---KLASTRCQGS-----GSFHVELIDALYQLFHE 526 Saccharomyces cerevisiae S288C
O28204 223 ACYNVAG---ELAAEKSSGT-----ASFRSNLIDEISKITAE 256 Archaeoglobus fulgidus DSM 4304
P39593 223 SSYGVAA----QLAAQQTADkg--pGSFQIELLNKLSTVTEQ 258 Bacillus subtilis subsp. subtilis str. 168
Q57233 221 VAYTIAG----ECAAQGLTTq---vGQFQIRLLDELAALSPE 255 Haemophilus influenzae Rd KW20
O25516 213 ALYKQAAfnaQKKVLENNGSn----GSFLFYFLDAL-SLPIE 249 Helicobacter pylori 26695
P55883 226 CWMKLAG---QAAAERSEGP-----GSFIPAFLDALYHLDVE 259 Salmonella enterica subsp. enterica serovar Typhimurium str...
P76423 226 HWMKQAG---ERAVARSEGP-----GSFVPHFLDALWQLTQE 259 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap