2RNN


Conserved Protein Domain Family
SAP

?
pfam02037: SAP 
Click on image for an interactive view with Cn3D
SAP domain
The SAP (after SAF-A/B, Acinus and PIAS) motif is a putative DNA/RNA binding domain found in diverse nuclear and cytoplasmic proteins.
Statistics
?
PSSM-Id: 396567
View PSSM: pfam02037
Aligned: 149 rows
Threshold Bit Score: 28.1273
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2RNN_A           37 MELLKVSELKDICRSVSFPVSGR-KAVLQDLIRNFL 71  baker's yeast
NP_724753        13 VQMLRVVELQKILSFLNISFAGR-KTDLQSRILSFL 47  fruit fly
Q1DH56           17 VHQLRVSDLQQLLGENNISRSGR-KSELIERVLILV 51  yellow fever mosquito
NP_956637        42 LETLRVTELRLLLSKMGKSKSGL-KKDLQKRVTDLl 76  zebrafish
EAW10195         14 LTTLKVSQLQHIAQATGIHSSGP-KAALLTRLRAQL 48  Aspergillus clavatus NRRL 1
Q4WNX5           14 LNNLRASQLQRIAQATGIQSSGT-KACLIARLKEEl 48  Aspergillus fumigatus
NP_956198       573 LGKLTVPVLKDACKQFNIRTTGTkKQELIDALTMql 608 zebrafish
XP_011388207    673 LSAYTVDELKSACDFYRLDKKGR-KADLLVRIDEHI 707 Ustilago maydis 521
Q0UFV4           16 SKTLINNDLKKICKEEGTSQTGN-KAALQARVVGLI 50  Parastagonospora nodorum SN15
jgi:OSTLU_32204 100 VKAMMLADLRTLCRQNGLSPAGS-RDTLIERVCEAI 134 Ostreococcus lucimarinus CCE9901
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap